BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0440 (710 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20G4.07c |sts1|erg4|C-24|Schizosaccharomyces pombe|chr 1|||M... 27 2.0 SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3||... 26 4.6 >SPAC20G4.07c |sts1|erg4|C-24|Schizosaccharomyces pombe|chr 1|||Manual Length = 453 Score = 27.5 bits (58), Expect = 2.0 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -1 Query: 323 AEGERELVSGFNIEYRRGGFALIFW 249 ++GE+ +V +++ Y + GF LIFW Sbjct: 257 SKGEQLIVPTWDMAYEKFGFMLIFW 281 >SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3|||Manual Length = 1315 Score = 26.2 bits (55), Expect = 4.6 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 264 CFNFLAEYSSILFIRM-ILVIINMGGYNLRFFFI 166 CF ++A YS+I FI + IL N + +F FI Sbjct: 1070 CFQYMALYSAIQFITVSILYTTNSNLGDFQFLFI 1103 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,508,404 Number of Sequences: 5004 Number of extensions: 21192 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -