BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0420 (697 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_12889| Best HMM Match : Peptidase_S9 (HMM E-Value=1.4e-38) 30 1.6 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 31.5 bits (68), Expect = 0.67 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -3 Query: 623 KLLLYSIYSITLRTLKRSTRLPVLRVCISIK-VNSCMPSNRCYP 495 +LLL S +TL +R +R LR CI I+ N PSN C P Sbjct: 35 RLLLLSELQLTLSGSERKSRFEDLRQCIQIQGSNWYPPSNSCSP 78 >SB_12889| Best HMM Match : Peptidase_S9 (HMM E-Value=1.4e-38) Length = 253 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -1 Query: 559 LFCACASQSRSILVCLLIAVIQRSDCHGFVVPAPYEVYPKMFM 431 L CACA+Q+ + C +IA + S H VP YP + + Sbjct: 139 LVCACANQAPELFGC-IIAQVPYSPLHNIKVPDNGAQYPPLML 180 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,414,710 Number of Sequences: 59808 Number of extensions: 394444 Number of successful extensions: 1083 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1007 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1079 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -