BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0420 (697 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC071556-1|AAH71556.1| 1244|Homo sapiens TTBK2 protein protein. 30 6.9 AK131372-1|BAD18523.1| 1167|Homo sapiens protein ( Homo sapiens ... 30 6.9 AF525400-1|AAO14996.1| 1649|Homo sapiens tau-tubulin kinase prot... 30 6.9 AB020654-1|BAA74870.1| 645|Homo sapiens KIAA0847 protein protein. 30 6.9 >BC071556-1|AAH71556.1| 1244|Homo sapiens TTBK2 protein protein. Length = 1244 Score = 30.3 bits (65), Expect = 6.9 Identities = 23/54 (42%), Positives = 27/54 (50%) Frame = +2 Query: 113 SSNEPIIAGRSRSKPLHDAL*GLRIFLMSTRTVNESGSSSSKRSCQYLSEVCQP 274 SS+ P AGR P HD S + SGSSSS+RSCQ E C+P Sbjct: 1164 SSSSPSRAGR----PHHDQRSSSPHLGRSKSPPSHSGSSSSRRSCQ--QEHCKP 1211 >AK131372-1|BAD18523.1| 1167|Homo sapiens protein ( Homo sapiens cDNA FLJ16421 fis, clone BRACE3003920, weakly similar to Serine/threonine-protein kinase K06H7.1 in chromosome III (EC 2.7.1.-). ). Length = 1167 Score = 30.3 bits (65), Expect = 6.9 Identities = 23/54 (42%), Positives = 27/54 (50%) Frame = +2 Query: 113 SSNEPIIAGRSRSKPLHDAL*GLRIFLMSTRTVNESGSSSSKRSCQYLSEVCQP 274 SS+ P AGR P HD S + SGSSSS+RSCQ E C+P Sbjct: 1095 SSSSPSRAGR----PHHDQRSSSPHLGRSKSPPSHSGSSSSRRSCQ--QEHCKP 1142 >AF525400-1|AAO14996.1| 1649|Homo sapiens tau-tubulin kinase protein. Length = 1649 Score = 30.3 bits (65), Expect = 6.9 Identities = 23/54 (42%), Positives = 27/54 (50%) Frame = +2 Query: 113 SSNEPIIAGRSRSKPLHDAL*GLRIFLMSTRTVNESGSSSSKRSCQYLSEVCQP 274 SS+ P AGR P HD S + SGSSSS+RSCQ E C+P Sbjct: 1569 SSSSPSRAGR----PHHDQRSSSPHLGRSKSPPSHSGSSSSRRSCQ--QEHCKP 1616 >AB020654-1|BAA74870.1| 645|Homo sapiens KIAA0847 protein protein. Length = 645 Score = 30.3 bits (65), Expect = 6.9 Identities = 23/54 (42%), Positives = 27/54 (50%) Frame = +2 Query: 113 SSNEPIIAGRSRSKPLHDAL*GLRIFLMSTRTVNESGSSSSKRSCQYLSEVCQP 274 SS+ P AGR P HD S + SGSSSS+RSCQ E C+P Sbjct: 565 SSSSPSRAGR----PHHDQRSSSPHLGRSKSPPSHSGSSSSRRSCQ--QEHCKP 612 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,375,536 Number of Sequences: 237096 Number of extensions: 1872217 Number of successful extensions: 3480 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3480 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8007229802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -