Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0413
         (685 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A5C3B7 Cluster: Putative uncharacterized protein; n=3; ...    34   2.8  

>UniRef50_A5C3B7 Cluster: Putative uncharacterized protein; n=3;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 452

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 20/73 (27%), Positives = 33/73 (45%)
 Frame = +2

Query: 440 NIINTLWKKCRQ*YDYYIVYTSHFQNVSVLFLYTKCELNKNMTRVFLKLCRFIEPYQSYR 619
           N I+ LW         Y+  T H QN++ L    K + N++++    +  + I   +SY 
Sbjct: 76  NSIDNLWDLSEAFVGQYLCSTQHKQNINTL-QNIKMQENESLSEFVKRFGQIILQVESYS 134

Query: 620 QCVCMYIFVRGLC 658
             V   IF R +C
Sbjct: 135 MDVVFQIFKRNIC 147


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 619,631,565
Number of Sequences: 1657284
Number of extensions: 11755115
Number of successful extensions: 27002
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 25834
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26992
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 53305790091
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)