BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0413 (685 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54030.1 68418.m06720 DC1 domain-containing protein contains ... 29 2.9 At1g23980.1 68414.m03028 zinc finger (C3HC4-type RING finger) fa... 28 5.0 At5g32169.1 68418.m03692 hypothetical protein 28 6.6 >At5g54030.1 68418.m06720 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 419 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/55 (34%), Positives = 25/55 (45%) Frame = +2 Query: 29 SLSLCLFLFPLHRSVKRLTQPCWKSH*KFHFKNECVQNFVKFNYTYTCLSVYYVY 193 S SLCLF L V R+ C K H +EC+ N + N + C + VY Sbjct: 34 SCSLCLFSTFLGEIVTRIRYQCMDCGLKLH--DECI-NSLSLNRPFLCNHILKVY 85 >At1g23980.1 68414.m03028 zinc finger (C3HC4-type RING finger) family protein low similarity to RING-H2 zinc finger protein ATL4 [Arabidopsis thaliana] GI:4928399; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 369 Score = 28.3 bits (60), Expect = 5.0 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +1 Query: 355 VIFTLNIQIYVCYLLHVIVNFYLFFSKFKYNKYPME 462 +I L++ ++C +LH++V +YL + + P E Sbjct: 56 IIVLLSVIFFICSILHLLVRYYLKKKRSNLSSSPNE 91 >At5g32169.1 68418.m03692 hypothetical protein Length = 258 Score = 27.9 bits (59), Expect = 6.6 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = +1 Query: 349 ENVIFTLNIQIYVCYLLHVI-VNFYLFFSKFKYNKYPMEEM*TVIRLLHCIYITFSERFR 525 E V + + +C L VI ++ YLF +F Y +I LLHC Y F+ Sbjct: 192 EEVSYLVLFPQTLCSRLFVIRISLYLFSIQFLYLISFTVVHSVIILLLHCCYHVFNLFNV 251 Query: 526 FVFVYEM 546 + F Y++ Sbjct: 252 YAFCYDV 258 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,557,162 Number of Sequences: 28952 Number of extensions: 260506 Number of successful extensions: 497 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 497 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -