BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0409 (736 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex lar... 29 0.69 SPCC31H12.07 |sec231|sec23a, SPCC5E4.01|GTPase activating protei... 25 8.5 >SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex large subunit Nuc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1689 Score = 29.1 bits (62), Expect = 0.69 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = -2 Query: 393 VTTLHPIFY---YLLVRSNFYYSHHNNLKMLDVNGIYC 289 + HP+F+ Y L+RS Y HH L + V+ +C Sbjct: 84 IPAYHPLFFSQMYNLLRSTCLYCHHFKLSKVKVHLFFC 121 >SPCC31H12.07 |sec231|sec23a, SPCC5E4.01|GTPase activating protein Sec23a|Schizosaccharomyces pombe|chr 3|||Manual Length = 759 Score = 25.4 bits (53), Expect = 8.5 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = -2 Query: 453 RYLTEVVNKFIVYKYNQ---FRLVT--TLHPIFYYLLVRSNFYYSHHNN 322 R L ++ KF Y+ + FRL + TL+P F Y L RS F +N+ Sbjct: 542 RMLIKLCQKFAEYRKDDPSSFRLSSQFTLYPQFMYYLRRSPFLQVFNNS 590 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,784,185 Number of Sequences: 5004 Number of extensions: 52897 Number of successful extensions: 96 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -