BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0406 (494 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 194 4e-50 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 129 1e-30 SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) 124 3e-29 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 3e-20 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 3e-11 SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 3e-08 SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) 55 4e-08 SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) 47 7e-06 SB_25376| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_54507| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_58426| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_57366| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_56245| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_55566| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_55077| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_53790| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_52894| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_48533| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_47211| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_46066| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_45109| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_43715| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_42865| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_41269| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_40020| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_38531| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_35148| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_31008| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_29391| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_24808| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_23019| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_21707| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_19542| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_19098| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_19031| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_17805| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_15695| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_12040| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_9760| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_5267| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_1707| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_1382| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_1275| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_6381| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_30985| Best HMM Match : DUF1450 (HMM E-Value=1.5) 45 3e-05 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 43 2e-04 SB_51245| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_24699| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 39 0.002 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_41802| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_34775| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_32513| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_32393| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_29655| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_26089| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_24687| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_15282| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_6708| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_2276| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 39 0.002 SB_59347| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 39 0.002 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 39 0.002 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_29950| Best HMM Match : A2M_comp (HMM E-Value=7.1) 38 0.003 SB_2327| Best HMM Match : HTH_1 (HMM E-Value=6.1e-11) 38 0.006 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 37 0.008 SB_55951| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_55453| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_51471| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_46397| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_27300| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_21455| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_20356| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_16282| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_6959| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_6102| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 37 0.010 SB_5610| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_2852| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_2781| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_45889| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_45032| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 37 0.010 SB_43474| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_42098| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_39127| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_25846| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_23237| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_21710| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.23 SB_52929| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_10138| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_2596| Best HMM Match : Extensin_2 (HMM E-Value=0.083) 29 2.1 SB_43823| Best HMM Match : MAM (HMM E-Value=0) 29 2.1 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 28 3.7 SB_49264| Best HMM Match : Ank (HMM E-Value=3.7e-22) 28 4.9 SB_4729| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_3987| Best HMM Match : Metallothio_PEC (HMM E-Value=8.6) 28 4.9 SB_32670| Best HMM Match : CIMR (HMM E-Value=0) 27 6.4 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 27 6.4 SB_57896| Best HMM Match : PCI (HMM E-Value=3.1) 27 8.5 SB_48339| Best HMM Match : BAG (HMM E-Value=5.9) 27 8.5 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 194 bits (472), Expect = 4e-50 Identities = 85/85 (100%), Positives = 85/85 (100%) Frame = +1 Query: 1 AQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVR 180 AQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVR Sbjct: 129 AQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVR 188 Query: 181 CRSFAPSWAVCTNPPFSPTAAPYPV 255 CRSFAPSWAVCTNPPFSPTAAPYPV Sbjct: 189 CRSFAPSWAVCTNPPFSPTAAPYPV 213 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 129 bits (312), Expect = 1e-30 Identities = 59/74 (79%), Positives = 62/74 (83%) Frame = +1 Query: 1 AQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVR 180 AQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAV I Sbjct: 158 AQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVAIRTA 217 Query: 181 CRSFAPSWAVCTNP 222 ++F S + P Sbjct: 218 KKTFQGSTSSMAAP 231 >SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 124 bits (300), Expect = 3e-29 Identities = 58/65 (89%), Positives = 59/65 (90%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAATGNRISRARYVRGATEFLKWSPNYGYTTRTVFGICALPKPVT 436 YRLESNPVRHDLSPLAAATGNRISRARYV GATEFLKW PNYGYT RTVFGICAL KPVT Sbjct: 25 YRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGYTRRTVFGICALLKPVT 84 Query: 437 SGKRV 451 GK + Sbjct: 85 FGKEL 89 Score = 63.7 bits (148), Expect = 8e-11 Identities = 47/106 (44%), Positives = 51/106 (48%), Gaps = 4/106 (3%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPLVTGLAERGMSAVLQSS* 365 VVRSKLGCVHEPPVQPDRCALSG L RH PL R A Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLE----SNPVRHDLSPLAAATGNRISRARYVGGA 56 Query: 366 SGRLT--TATLQEQYLVSALCPSQLPPE--KESVALDPADKPPLVA 491 + L + V +C P KE VALDPA+K PLVA Sbjct: 57 TEFLKWWPNYGYTRRTVFGICALLKPVTFGKELVALDPANKTPLVA 102 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 95.1 bits (226), Expect = 3e-20 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAATGNRISRARYVRGATEFLKWSPNYGYT 391 YRLESNPVRHDLSPLAAATGNRISRARYV GATEFLKW PNYGYT Sbjct: 25 YRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGYT 69 Score = 56.0 bits (129), Expect = 2e-08 Identities = 29/50 (58%), Positives = 29/50 (58%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPLVTGLAER 335 VVRSKLGCVHEPPVQPDRCALSG L RH PL R Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLE----SNPVRHDLSPLAAATGNR 46 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 65.3 bits (152), Expect = 3e-11 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +1 Query: 1 AQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLP 105 AQ+ GGETRQDYKDTRRFPL APSCALLF P LP Sbjct: 128 AQISGGETRQDYKDTRRFPLAAPSCALLFLPFGLP 162 >SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 58.4 bits (135), Expect = 3e-09 Identities = 32/52 (61%), Positives = 34/52 (65%), Gaps = 2/52 (3%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSGTIVL--SPTR*DTTYRHWQQPLVTGLAER 335 VVRSKLGCVHEPPVQPDRCALSG L +P R PLV +AER Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVR-HRLIATGSSPLVNRIAER 51 >SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 2e-08 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSGTIVL--SPTR*D 284 VVRSKLGCVHEPPVQPDRCALSG L +P R D Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHD 35 Score = 43.2 bits (97), Expect = 1e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNPVRHDLSPLAAAT Sbjct: 25 YRLESNPVRHDLSPLAAAT 43 >SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.6 bits (128), Expect = 2e-08 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSGTIVL--SPTR*D 284 VVRSKLGCVHEPPVQPDRCALSG L +P R D Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHD 35 Score = 43.2 bits (97), Expect = 1e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNPVRHDLSPLAAAT Sbjct: 25 YRLESNPVRHDLSPLAAAT 43 >SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 55.2 bits (127), Expect = 3e-08 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSGTIVL--SPTR*D 284 VVRSKLGCVHEPPVQPDRCALSG L P R D Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESKPVRHD 35 Score = 40.7 bits (91), Expect = 6e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLES PVRHDLSPLAAAT Sbjct: 25 YRLESKPVRHDLSPLAAAT 43 >SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) Length = 75 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 45 VVRSKLGCVHEPPVQPDRCALSG 67 >SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 34 VVRSKLGCVHEPPVQPDRCALSG 56 >SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 186 VVRSKLGCVHEPPVQPDRCALSG 254 VVRSKLGCVHEPPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 52.8 bits (121), Expect = 1e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 87 EQESARGSFQGETPGIFIVLSGFATSDLS 1 EQESARGS QGET GIFIVLSGFAT+DLS Sbjct: 10 EQESARGSRQGETLGIFIVLSGFATTDLS 38 >SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 47.6 bits (108), Expect = 6e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +3 Query: 195 SKLGCVHEPPVQPDRCALSG 254 S LGCVHEPPVQPDRCALSG Sbjct: 56 SNLGCVHEPPVQPDRCALSG 75 Score = 41.5 bits (93), Expect = 4e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAATGNRI 325 YRLESNP R DLSPL ATGNRI Sbjct: 77 YRLESNPGRPDLSPLGTATGNRI 99 >SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) Length = 108 Score = 47.2 bits (107), Expect = 7e-06 Identities = 25/49 (51%), Positives = 28/49 (57%) Frame = +3 Query: 168 YLSSV*VVRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 + V VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 59 FFRGVKAVRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 103 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 89 YRLESNPERHAKAPLAAAT 107 >SB_25376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 46.8 bits (106), Expect = 1e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 165 YSVSYEKAPRFPKGERRTGI 106 YSVSYEKAPRFPKGERRTGI Sbjct: 14 YSVSYEKAPRFPKGERRTGI 33 Score = 34.3 bits (75), Expect = 0.056 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = -2 Query: 205 PSLERTTYTELRYLQREL*ESATLPEGRK 119 PSLERTTYTELRY ++ P+G + Sbjct: 1 PSLERTTYTELRYYSVSYEKAPRFPKGER 29 >SB_54507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 15 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 52 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 38 YRLESNPERHAKAPLAAAT 56 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.4 bits (105), Expect = 1e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 311 WLLPVAISRVLPGWTQDDS 255 WLLPVAISRVLPGWTQDDS Sbjct: 1 WLLPVAISRVLPGWTQDDS 19 >SB_58426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_57366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_56245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_55566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_55077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_53790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_52894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_48533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_47211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_46066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_45109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 129 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 166 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 152 YRLESNPERHAKAPLAAAT 170 >SB_43715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_42865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_41269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_40020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_38531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_35148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_31008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_29391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_24808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_23019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_21707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 22 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 59 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 45 YRLESNPERHAKAPLAAAT 63 >SB_19542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_19098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_19031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_17805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_15695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_12040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_9760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_5267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_1707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_1382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_1275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 VRSKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 39 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 25 YRLESNPERHAKAPLAAAT 43 >SB_6381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 27 Score = 46.0 bits (104), Expect = 2e-05 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 201 LGCVHEPPVQPDRCALSG 254 LGCVHEPPVQPDRCALSG Sbjct: 2 LGCVHEPPVQPDRCALSG 19 >SB_30985| Best HMM Match : DUF1450 (HMM E-Value=1.5) Length = 599 Score = 45.2 bits (102), Expect = 3e-05 Identities = 23/48 (47%), Positives = 27/48 (56%) Frame = +3 Query: 189 VRSKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPLVTGLAE 332 VRS+L C+HEPPVQ DRCALSG L RH + PL + Sbjct: 358 VRSQLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPLAAATVD 401 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 42.7 bits (96), Expect = 2e-04 Identities = 19/35 (54%), Positives = 21/35 (60%) Frame = +1 Query: 1 AQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLP 105 AQ+ GGETRQDYKDTRR C +L P P Sbjct: 166 AQISGGETRQDYKDTRRLHQAGTLCGVLILPFGFP 200 >SB_51245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 42.7 bits (96), Expect = 2e-04 Identities = 22/40 (55%), Positives = 24/40 (60%) Frame = +3 Query: 195 SKLGCVHEPPVQPDRCALSGTIVLSPTR*DTTYRHWQQPL 314 SKL C+HEPPVQ DRCALSG L RH + PL Sbjct: 5 SKLDCMHEPPVQSDRCALSGNYRLE----SNPERHAKAPL 40 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 257 YRLESNPVRHDLSPLAAAT 313 YRLESNP RH +PLAAAT Sbjct: 26 YRLESNPERHAKAPLAAAT 44 >SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 42.3 bits (95), Expect = 2e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 165 RYLSSV*VVRSKLGCVHEPPVQPDRCALS 251 RYL+ RSKL C+HEPPVQ DRCALS Sbjct: 100 RYLTGK-QFRSKLDCMHEPPVQSDRCALS 127 >SB_24699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 40.7 bits (91), Expect = 6e-04 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = -1 Query: 152 MRKRHASRREKGGQVSGKRQGRNRRAHEGASRGKRLVS 39 MRKRHASRREKGGQVSG + G KR+VS Sbjct: 1 MRKRHASRREKGGQVSGNSYDHDYEFELGTLE-KRIVS 37 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 40.3 bits (90), Expect = 9e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 152 MRKRHASRREKGGQVSGKR 96 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 40.3 bits (90), Expect = 9e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 152 MRKRHASRREKGGQVSGKR 96 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 40.3 bits (90), Expect = 9e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 152 MRKRHASRREKGGQVSGKR 96 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,769,612 Number of Sequences: 59808 Number of extensions: 414482 Number of successful extensions: 1846 Number of sequences better than 10.0: 369 Number of HSP's better than 10.0 without gapping: 1547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1833 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1062812967 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -