BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0405 (737 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 25 0.48 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 7.9 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 7.9 AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 21 7.9 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 7.9 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 25.4 bits (53), Expect = 0.48 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 175 HHASHHPFSCFRGRGRLSVRESEIPRIAARLSLNA 71 HH + H +CF RG L + E ++ L L+A Sbjct: 367 HHLARHAVACFLTRGDLWLSWEEGMKVFEELLLDA 401 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 33 RLRRFVATTSRPYALRLSRAAIRGIS 110 RL V++ S+P ALRLS + + ++ Sbjct: 376 RLVLTVSSVSKPEALRLSGSVVTKVT 401 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 4/28 (14%) Frame = +3 Query: 81 LSRAAIRGIS----DSRTERRPRPRKQE 152 LS +++ G S DS+ ++ P PR+QE Sbjct: 158 LSPSSLNGYSADSCDSKKKKGPTPRQQE 185 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = -3 Query: 255 LSLVLKTAQLDFELVETAVQLGDVRASIMQ 166 L+L+ Q FE++ + GDV ++ ++ Sbjct: 105 LNLIFLLIQTRFEMINNIITRGDVTSTTIK 134 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -2 Query: 172 HASHHPFSCFRGRGRLSVR 116 H + PF C + RGR R Sbjct: 241 HTNEKPFECDKCRGRFRRR 259 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,201 Number of Sequences: 336 Number of extensions: 2130 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -