BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0405 (737 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 27 0.14 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 26 0.42 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 4.0 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 22 5.2 AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. 22 5.2 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 22 6.9 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 22 6.9 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 22 6.9 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 22 6.9 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 9.1 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 9.1 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 9.1 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 9.1 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 27.5 bits (58), Expect = 0.14 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +1 Query: 517 ELSLDVANKTNIDLQKTIKKQSLQLTEIQTHYDEVQRQLQVTLDQYGVAQ 666 +L L+V +T++ KK S L ++ + +QLQ+T QY + Q Sbjct: 152 QLQLNVIQQTHLLQTADKKKASAPLQQLALQQQRLIQQLQITQSQYLLQQ 201 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 25.8 bits (54), Expect = 0.42 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 175 HHASHHPFSCFRGRGRLSVRESEIPRIAARLSLNA 71 HH + H +CF RG L + E ++ L L+A Sbjct: 371 HHLARHAVACFLTRGDLWISWEEGMKVFDELLLDA 405 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +1 Query: 88 EQQYEESQTREQKDALARENKKMGDDLHDARA 183 +QQ ++ Q ++Q+ ARE + +G + + A Sbjct: 1220 QQQQQQQQQQQQQQHQAREREGVGAGIAETSA 1251 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 104 NLRLANRKTPSPAKTRK 154 NL +NRK P+PA +K Sbjct: 384 NLDPSNRKLPAPANWKK 400 >AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. Length = 50 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +2 Query: 470 EVTRIKKKLQIQILNWNSLLMW 535 +V ++KKK + + LN N +++W Sbjct: 2 KVHQLKKKRRKKNLNQNQMMIW 23 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 21.8 bits (44), Expect = 6.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 52 QLRAGPTR*GSVEQQYEESQTREQKDALARENKKMG 159 QL G + S E Y E++ E K ++ KK+G Sbjct: 74 QLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKKIG 109 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 21.8 bits (44), Expect = 6.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 52 QLRAGPTR*GSVEQQYEESQTREQKDALARENKKMG 159 QL G + S E Y E++ E K ++ KK+G Sbjct: 90 QLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKKIG 125 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 52 QLRAGPTR*GSVEQQYEESQTREQKDALARENKKMG 159 QL G + S E Y E++ E K ++ KK+G Sbjct: 147 QLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKKIG 182 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 21.8 bits (44), Expect = 6.9 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = +1 Query: 91 QQYEESQTREQKDALARENKKMG 159 QQ ++ Q ++Q+D ++ +MG Sbjct: 89 QQQQQQQQQQQQDQQQQQQSRMG 111 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 361 SSAREGRRNRSHPQADKHRNRTAERSR 441 S RE ++ + K+R R+ ERSR Sbjct: 42 SREREQNSYKNEKEYRKYRERSKERSR 68 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 361 SSAREGRRNRSHPQADKHRNRTAERSR 441 S RE ++ + K+R R+ ERSR Sbjct: 42 SREREQNSYKNEKEYRKYRERSKERSR 68 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 361 SSAREGRRNRSHPQADKHRNRTAERSR 441 S RE + ++ + K+R R+ ERSR Sbjct: 42 SREREQKSYKNERKYRKYRERSKERSR 68 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 361 SSAREGRRNRSHPQADKHRNRTAERSR 441 S RE + ++ + K+R R+ ERSR Sbjct: 42 SREREQKSYKNERKYRKYRERSKERSR 68 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,319 Number of Sequences: 438 Number of extensions: 3009 Number of successful extensions: 21 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -