BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0394 (551 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0483 + 19546295-19546397,19547163-19547482,19547606-195486... 27 7.5 01_01_0888 + 6990354-6991862,6991970-6992431 27 10.0 >12_02_0483 + 19546295-19546397,19547163-19547482,19547606-19548611, 19549890-19549985,19550500-19551551 Length = 858 Score = 27.5 bits (58), Expect = 7.5 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 6/45 (13%) Frame = -2 Query: 271 LINKNIK------LDLSFYNIINWVIYE*ERSKFRLHYRKVYSMI 155 L+N+N + +D SFYNIIN RSKFRL + ++S I Sbjct: 277 LVNRNFESYITRIIDTSFYNIIN-DPKGITRSKFRLFHNVLFSKI 320 >01_01_0888 + 6990354-6991862,6991970-6992431 Length = 656 Score = 27.1 bits (57), Expect = 10.0 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +3 Query: 48 EATEKKVENQQKNPCKIALVENY--DLVRVANQLRT*VII 161 E + +V ++Q +PC++ALVE LVR +Q V++ Sbjct: 200 ELDKLRVHHEQPSPCRLALVEQLACTLVRSRSQRAAVVVV 239 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,968,276 Number of Sequences: 37544 Number of extensions: 168012 Number of successful extensions: 193 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1245816180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -