BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0388 (670 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L07880-1|AAA29358.1| 218|Anopheles gambiae glutathione S-transf... 80 7e-17 AF513639-1|AAM53611.1| 195|Anopheles gambiae glutathione S-tran... 77 5e-16 Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein prot... 26 0.93 AF515522-1|AAM61889.1| 222|Anopheles gambiae glutathione S-tran... 26 0.93 AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-tran... 26 0.93 AY017417-1|AAG54081.1| 383|Anopheles gambiae arrestin protein. 25 2.2 AJ304409-1|CAC39103.2| 383|Anopheles gambiae arrestin protein. 25 2.2 AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-tran... 24 5.0 AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 24 5.0 AF045250-1|AAC02700.1| 259|Anopheles gambiae serine proteinase ... 24 5.0 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 23 6.6 AF071162-1|AAC79998.1| 216|Anopheles gambiae glutathione S-tran... 23 8.7 AF071160-2|AAC79994.1| 216|Anopheles gambiae glutathione S-tran... 23 8.7 >L07880-1|AAA29358.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 79.8 bits (188), Expect = 7e-17 Identities = 37/79 (46%), Positives = 46/79 (58%) Frame = +1 Query: 40 MPKVVYHYFACKALGESGRMLLAYGGQDFEDHRVLSADWPDFKPKTPFGQMPVLVIDGKQ 219 MP +YF KALGE R LL+YG F+D R+ +WP KP P QMPVL +DGK+ Sbjct: 16 MPDYKVYYFNVKALGEPLRFLLSYGNLPFDDVRITREEWPALKPTMPMRQMPVLEVDGKR 75 Query: 220 YAQSTAICRYLGASTGSPG 276 QS A+CRY+ G Sbjct: 76 VHQSLAMCRYVAKQINLAG 94 Score = 72.9 bits (171), Expect = 8e-15 Identities = 37/88 (42%), Positives = 48/88 (54%) Frame = +3 Query: 255 RKYGLAGANDEEAFEIDQNVEFLHDIRAKAAAVYYEADEELKAKKHEDFSKNVYPDMLKK 434 ++ LAG N EA +ID V+ ++D R K A V YE D+ +K KK + V P L K Sbjct: 88 KQINLAGDNPLEALQIDAIVDTINDFRLKIAIVAYEPDDMVKEKKMVTLNNEVIPFYLTK 147 Query: 435 LNSIVEANKGHIAAGKLTWGDFVFTACL 518 LN I + N GH+ GK TW D F L Sbjct: 148 LNVIAKENNGHLVLGKPTWADVYFAGIL 175 >AF513639-1|AAM53611.1| 195|Anopheles gambiae glutathione S-transferase S1-2 protein. Length = 195 Score = 77.0 bits (181), Expect = 5e-16 Identities = 39/85 (45%), Positives = 51/85 (60%) Frame = +3 Query: 264 GLAGANDEEAFEIDQNVEFLHDIRAKAAAVYYEADEELKAKKHEDFSKNVYPDMLKKLNS 443 GLAGA+D E ID V+ ++D R K A V YE D+E+K KK + V P L+KL+ Sbjct: 68 GLAGADDWENLMIDTVVDTVNDFRLKIAVVSYEPDDEIKEKKLVTLNNEVIPFYLEKLDD 127 Query: 444 IVEANKGHIAAGKLTWGDFVFTACL 518 I N G++A KL+W D FTA L Sbjct: 128 IARDNNGYLANSKLSWADIYFTAIL 152 Score = 76.6 bits (180), Expect = 7e-16 Identities = 36/71 (50%), Positives = 43/71 (60%) Frame = +1 Query: 64 FACKALGESGRMLLAYGGQDFEDHRVLSADWPDFKPKTPFGQMPVLVIDGKQYAQSTAIC 243 F KALGE R LL+YG F+D R+ +WP KP P GQMPVL +DGK+ QS A+ Sbjct: 1 FNVKALGEPLRFLLSYGNLPFDDVRITREEWPALKPTMPMGQMPVLEVDGKKVHQSVAMS 60 Query: 244 RYLGASTGSPG 276 RYL G G Sbjct: 61 RYLANQVGLAG 71 >Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein protein. Length = 209 Score = 26.2 bits (55), Expect = 0.93 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 157 PDFKPKTPFGQMPVLVIDGKQYAQSTAICRYLGASTG 267 P+F P +P LV +G +S AIC YL G Sbjct: 41 PEFLKINPQHCIPTLVDNGFALWESRAICTYLAEKYG 77 >AF515522-1|AAM61889.1| 222|Anopheles gambiae glutathione S-transferase protein. Length = 222 Score = 26.2 bits (55), Expect = 0.93 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 160 DFKPKTPFGQMPVLVIDGKQYAQSTAICRYL 252 +++ P Q+P L IDG +S +I YL Sbjct: 55 EYREVNPMEQVPALQIDGHTLIESVSIMYYL 85 >AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 26.2 bits (55), Expect = 0.93 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 157 PDFKPKTPFGQMPVLVIDGKQYAQSTAICRYLGASTG 267 P+F P +P LV +G +S AIC YL G Sbjct: 41 PEFLKINPQHCIPTLVDNGFALWESRAICTYLAEKYG 77 >AY017417-1|AAG54081.1| 383|Anopheles gambiae arrestin protein. Length = 383 Score = 25.0 bits (52), Expect = 2.2 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 49 VVYHYFACKALGESGRMLLAYGGQDFEDH 135 +VY++ K +G++ L G +DF DH Sbjct: 1 MVYNFKVFKKCAPNGKVTLYMGKRDFVDH 29 >AJ304409-1|CAC39103.2| 383|Anopheles gambiae arrestin protein. Length = 383 Score = 25.0 bits (52), Expect = 2.2 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 49 VVYHYFACKALGESGRMLLAYGGQDFEDH 135 +VY++ K +G++ L G +DF DH Sbjct: 1 MVYNFKVFKKCAPNGKVTLYMGKRDFVDH 29 >AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-transferase u1 protein. Length = 233 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 160 DFKPKTPFGQMPVLVIDGKQYAQSTAICRYL 252 +++ P ++PVL DG ++S AI +YL Sbjct: 42 EYEKMNPQKEIPVLDDDGFFLSESNAILQYL 72 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 23.8 bits (49), Expect = 5.0 Identities = 17/51 (33%), Positives = 22/51 (43%) Frame = +2 Query: 38 KCLRLCTITSLARLSGRAAVCCSPTEARTSKTTACSPLTGLTSSQRLRSVR 190 KC R IT + + A VCC ++ S + S T L S R S R Sbjct: 40 KCKRGNRITVCSYSATEAIVCCPQSQQLDSPPSGFSIPTPLNSQSRGGSER 90 >AF045250-1|AAC02700.1| 259|Anopheles gambiae serine proteinase protein. Length = 259 Score = 23.8 bits (49), Expect = 5.0 Identities = 17/105 (16%), Positives = 44/105 (41%), Gaps = 1/105 (0%) Frame = +3 Query: 174 DSVRSDASISDRRQAVRSE-HRHLQVPRRKYGLAGANDEEAFEIDQNVEFLHDIRAKAAA 350 +++ + + + RR R E H + +Y + ++ +N++ + + K Sbjct: 86 NNIAHEEAGAQRRNVTRYEQHESYDLSAIRYDIGVLQLSHPLDLTRNIKTMR-LATKDTL 144 Query: 351 VYYEADEELKAKKHEDFSKNVYPDMLKKLNSIVEANKGHIAAGKL 485 ++ + + +++YPD L K+N I+ + GK+ Sbjct: 145 IHQKIAKFAGWGSISKTWEDIYPDKLMKVNLILRTEEDCQTIGKI 189 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.4 bits (48), Expect = 6.6 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 551 LEVQYPAFKKVLQSVLTQPKVKAF 622 L Q+P + L+ LTQP V F Sbjct: 221 LSAQFPKIARTLRVKLTQPDVAEF 244 >AF071162-1|AAC79998.1| 216|Anopheles gambiae glutathione S-transferase D1-4 protein. Length = 216 Score = 23.0 bits (47), Expect = 8.7 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +1 Query: 157 PDFKPKTPFGQMPVLVIDGKQYAQSTAICRYLGASTGSP 273 P+F P +P LV G +S AI YL G P Sbjct: 41 PEFLKLNPQHCVPTLVDSGFALWESRAIMCYLVEKYGKP 79 >AF071160-2|AAC79994.1| 216|Anopheles gambiae glutathione S-transferase protein. Length = 216 Score = 23.0 bits (47), Expect = 8.7 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +1 Query: 157 PDFKPKTPFGQMPVLVIDGKQYAQSTAICRYLGASTGSP 273 P+F P +P LV G +S AI YL G P Sbjct: 41 PEFLKLNPQHCVPTLVDSGFALWESRAIMCYLVEKYGKP 79 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 644,846 Number of Sequences: 2352 Number of extensions: 12275 Number of successful extensions: 65 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -