BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0364 (393 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC23E6.05 |arx1||ribosomal export complex Arx1 |Schizosaccharo... 26 1.8 SPBC1271.01c |pof13||F-box protein Pof13|Schizosaccharomyces pom... 26 2.4 SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schiz... 25 5.5 SPAC30D11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 25 5.5 SPAC3H1.12c |snt2||Lid2 complex subunit Snt2 |Schizosaccharomyce... 24 7.3 SPBC18H10.08c |ubp4||ubiquitin C-terminal hydrolase Ubp4|Schizos... 24 7.3 SPBC776.02c |dis2|sds1, bws1|serine/threonine protein phosphatas... 24 9.7 >SPBC23E6.05 |arx1||ribosomal export complex Arx1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 417 Score = 26.2 bits (55), Expect = 1.8 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 7/58 (12%) Frame = -2 Query: 305 PLRALSEHNDLCNLQYSNQWNVNY-LKLLLLVSHVFEYLK------FHY*SIVTMRNV 153 P+ +L EH DL Y + NV+Y LKL S + E K FH+ S+ + RN+ Sbjct: 275 PISSLKEHPDLKPTLYIHDVNVSYMLKLKASRSLLSEIKKEKSVFPFHFGSLSSERNL 332 >SPBC1271.01c |pof13||F-box protein Pof13|Schizosaccharomyces pombe|chr 2|||Manual Length = 396 Score = 25.8 bits (54), Expect = 2.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 225 VTACFSCI*IFKVPLLKYCYDEKCVL 148 V AC C+ +K P+ +YC D + L Sbjct: 280 VPACIYCLREWKKPICRYCIDLRSCL 305 >SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 926 Score = 24.6 bits (51), Expect = 5.5 Identities = 12/48 (25%), Positives = 26/48 (54%) Frame = -2 Query: 329 VKEYCEXXPLRALSEHNDLCNLQYSNQWNVNYLKLLLLVSHVFEYLKF 186 V+++C P ++ +H +Y W V+ L L +++ VF+ ++F Sbjct: 830 VQDHCYRKP-QSYEDHYQDIRTRYVLVWAVSNLILAIVLIQVFDGMRF 876 >SPAC30D11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 85 Score = 24.6 bits (51), Expect = 5.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 305 PLRALSEHNDLCNLQYSNQWNVNYLKLLLL 216 PL++ H C L +S + N NYL ++ L Sbjct: 35 PLKSHRTHGHYCLLNFSLRENKNYLIIVYL 64 >SPAC3H1.12c |snt2||Lid2 complex subunit Snt2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1131 Score = 24.2 bits (50), Expect = 7.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 Query: 117 HCILCIISTLHNIFIVTILQ*W 52 HC+LC+ S H++ T+ W Sbjct: 906 HCVLCLQSASHSLMKKTVEGNW 927 >SPBC18H10.08c |ubp4||ubiquitin C-terminal hydrolase Ubp4|Schizosaccharomyces pombe|chr 2|||Manual Length = 438 Score = 24.2 bits (50), Expect = 7.3 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 6/52 (11%) Frame = -1 Query: 372 LNCHLHYIILCISL------GKGVLRVXASTRPLGTQRPLQPAIFQSMECKL 235 +NC L + C L G+G+L+ + PLGT + A F ++ L Sbjct: 83 MNCVLQCLFACKDLTIPMLQGRGLLQNINTKNPLGTGGKITSAFFSLLQSVL 134 >SPBC776.02c |dis2|sds1, bws1|serine/threonine protein phosphatase PP1|Schizosaccharomyces pombe|chr 2|||Manual Length = 327 Score = 23.8 bits (49), Expect = 9.7 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 240 KLFKTVTACFSCI 202 KL+KT T CF+C+ Sbjct: 146 KLWKTFTDCFNCL 158 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,555,853 Number of Sequences: 5004 Number of extensions: 28624 Number of successful extensions: 47 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 130061696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -