BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0364 (393 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0729 + 27203481-27203488,27203529-27203611,27204075-272041... 29 1.8 01_01_0763 + 5898719-5899021,5899124-5899518,5899619-5899703,589... 26 9.4 >03_05_0729 + 27203481-27203488,27203529-27203611,27204075-27204190, 27204298-27204330,27205196-27205402,27205532-27205600, 27206096-27206192,27206289-27206407 Length = 243 Score = 28.7 bits (61), Expect = 1.8 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = -1 Query: 192 KVPLLKYCYDEKCVLRV*PLP*DIEHCILCIISTLHNIFIVTILQ*WNFKYS 37 KV + Y Y E+ R PL D ++C C+ S ++ +++ WN +S Sbjct: 69 KVATIFYSYREQIEARGLPLTPDQKYCFRCLHSVQLHLIQKLLMELWNNDWS 120 >01_01_0763 + 5898719-5899021,5899124-5899518,5899619-5899703, 5899810-5900032,5900131-5900327,5900531-5900601, 5904034-5904218,5905914-5906068,5906241-5907632, 5907973-5908269 Length = 1100 Score = 26.2 bits (55), Expect = 9.4 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 393 RIIVQLPLNCHLHYIILCISLGKGVLRVXASTRPLGTQRPLQ 268 R+I +LP + YII + VL V R G ++PL+ Sbjct: 646 RVIAELPADSFGAYIISMATAPSDVLAVELLQRECGVKKPLR 687 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,056,572 Number of Sequences: 37544 Number of extensions: 153368 Number of successful extensions: 265 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 265 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 672845152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -