Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0364
         (393 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF100307-9|AAC68938.1|  321|Caenorhabditis elegans Hypothetical ...    27   6.3  

>AF100307-9|AAC68938.1|  321|Caenorhabditis elegans Hypothetical
           protein T12B5.11 protein.
          Length = 321

 Score = 26.6 bits (56), Expect = 6.3
 Identities = 10/36 (27%), Positives = 19/36 (52%)
 Frame = +2

Query: 5   KTVHCLFSHVFEYLKFHY*SIVTIKILCNVLIMHSI 112
           K+V C+     + + F +  ++TI   CN  ++ SI
Sbjct: 153 KSVKCIHVKTIKLVNFSFNDVITILQYCNTKVLESI 188


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,567,187
Number of Sequences: 27780
Number of extensions: 161134
Number of successful extensions: 315
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 304
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 315
length of database: 12,740,198
effective HSP length: 74
effective length of database: 10,684,478
effective search space used: 598330768
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)