BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0362 (427 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 26 0.18 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 25 0.31 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 23 1.2 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 1.6 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 1.6 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 25.8 bits (54), Expect = 0.18 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 76 AINIHEHAGRGIRQPSPAPHLRRLPA 153 A+ + + AG G R P PA R LPA Sbjct: 318 AVQVPQLAGGGRRGPGPARSRRHLPA 343 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 25.0 bits (52), Expect = 0.31 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 247 KYGSFSDANYCLIFSLLHDVYVEGRDGDLVQRL 149 KYG F+DA C D Y E DG + ++L Sbjct: 42 KYGFFADAEQC-------DKYYECNDGQITEKL 67 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 23.0 bits (47), Expect = 1.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 83 LIACVGSSIDGTHSFPVCSHRLK 15 L ACVGS+I G +C LK Sbjct: 5 LTACVGSAIAGFLFLLICDSYLK 27 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.6 bits (46), Expect = 1.6 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -1 Query: 283 YFKLNKFSLKCWKYGSFSDANYCLIFSLLHDV 188 + + K +++ + G F D LIFSL+ +V Sbjct: 724 FISIAKHNVRTFSAGGFFDIRKNLIFSLIANV 755 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 22.6 bits (46), Expect = 1.6 Identities = 10/27 (37%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 94 HAGRGIRQPSPAPHLRRLPAAGQG-PR 171 H G G+ P P + + PA G+ PR Sbjct: 10 HTGGGLMPPQPYMNAQDAPAGGENEPR 36 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,142 Number of Sequences: 336 Number of extensions: 1836 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9490410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -