BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0362 (427 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6783| Best HMM Match : Porphobil_deamC (HMM E-Value=5.8) 64 6e-11 SB_20701| Best HMM Match : DUF1027 (HMM E-Value=2.4) 29 2.1 SB_24967| Best HMM Match : Drf_FH1 (HMM E-Value=0.65) 28 3.7 SB_33149| Best HMM Match : DSL (HMM E-Value=5.60519e-45) 27 4.9 SB_53461| Best HMM Match : Amelogenin (HMM E-Value=0.099) 27 6.5 SB_6056| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-14) 27 6.5 SB_973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_6783| Best HMM Match : Porphobil_deamC (HMM E-Value=5.8) Length = 382 Score = 63.7 bits (148), Expect = 6e-11 Identities = 24/52 (46%), Positives = 38/52 (73%) Frame = +2 Query: 44 SEFRLCYYPHKLSTFTSMLDEAFDNRARHHIYGDFQPLDKVPVPAFYIHVMQ 199 S+FRL Y PH+L+ F+++L + F A H +GDF+PL K+ PA+Y+H++Q Sbjct: 318 SKFRLSYCPHRLANFSNLLKDIFGKNAEHITFGDFKPLGKIENPAYYVHLIQ 369 >SB_20701| Best HMM Match : DUF1027 (HMM E-Value=2.4) Length = 229 Score = 28.7 bits (61), Expect = 2.1 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +2 Query: 11 DTSNDGSKQEKSEFRLCYYPHKLSTFTSMLDEAFDNRAR 127 DT+ + + + LCYYP + TS ++ A +++ R Sbjct: 52 DTNQPSTNRRSNRRGLCYYPKDVLMMTSGMERAVEHKKR 90 >SB_24967| Best HMM Match : Drf_FH1 (HMM E-Value=0.65) Length = 1799 Score = 27.9 bits (59), Expect = 3.7 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 2/67 (2%) Frame = +1 Query: 31 QTGKE*VPSMLLPTQAINIHEHAGRGIRQPSPAPHLRRLPAAGQGPRPCLLHTRHAED-- 204 Q G++ V M +P + +G R+P+ AP LP + PRP L + + Sbjct: 1699 QDGEQRVTKMEIPVKG------SGEQARKPNQAPRKTHLPENNRVPRPRRLSKKEMRELN 1752 Query: 205 *KLNNNL 225 KL NNL Sbjct: 1753 QKLYNNL 1759 >SB_33149| Best HMM Match : DSL (HMM E-Value=5.60519e-45) Length = 443 Score = 27.5 bits (58), Expect = 4.9 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -2 Query: 192 TCM*KAGTGTLSSGWKSP*MWCRARLSNASSSMLVN 85 TC + G+ T SGW P CR RL +AS+ N Sbjct: 136 TCDSQTGSKTCLSGWSGPECDCRPRL-DASAGYTCN 170 >SB_53461| Best HMM Match : Amelogenin (HMM E-Value=0.099) Length = 2489 Score = 27.1 bits (57), Expect = 6.5 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = -3 Query: 377 TAKEKSKSKLFPISLKSKEFKIDVDLNR 294 T+ EK ++ + P ++K ++FKID D NR Sbjct: 634 TSYEK-QATISPFNVKEQDFKIDADSNR 660 >SB_6056| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-14) Length = 270 Score = 27.1 bits (57), Expect = 6.5 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 13 YFKRWEQTGKE*VPSM 60 YFKRW+QTGK V + Sbjct: 21 YFKRWKQTGKSSVSKL 36 >SB_973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 26.6 bits (56), Expect = 8.6 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 97 AGRGIRQPSPAPHLRRLPAAGQGPRPCLLHT 189 +G QP+ P LRRL G GPRP + H+ Sbjct: 303 SGNRNTQPTRRP-LRRLGTTGYGPRPGVGHS 332 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,087,484 Number of Sequences: 59808 Number of extensions: 225592 Number of successful extensions: 495 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 814166562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -