BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0356 (287 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB2B2.10c |||galactose-1-phosphate uridylyltransferase |Schiz... 23 6.7 SPAC1556.01c |rad50|SPAP4C9.01c|DNA repair protein Rad50|Schizos... 23 6.7 SPAC3H8.05c |||conserved fungal protein|Schizosaccharomyces pomb... 23 8.8 SPACUNK4.10 |||hydroxyacid dehydrogenase |Schizosaccharomyces po... 23 8.8 SPAC16A10.07c |taz1|myb1, myb|human TRF ortholog Taz1|Schizosacc... 23 8.8 >SPBPB2B2.10c |||galactose-1-phosphate uridylyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 369 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 232 DNRRVALASALRQETRKYD 176 + ++V LASAL+ T KYD Sbjct: 268 EKQKVDLASALKMLTTKYD 286 >SPAC1556.01c |rad50|SPAP4C9.01c|DNA repair protein Rad50|Schizosaccharomyces pombe|chr 1|||Manual Length = 1290 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +1 Query: 49 RTRSDRVSFRSTHSDGIIKLITHALKIPKKNFLI 150 RT+ + SF+ D ++ LK+ K NF + Sbjct: 839 RTKLEETSFKKKIDDAVLANNEQKLKLTKLNFQV 872 >SPAC3H8.05c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1073 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +1 Query: 34 EFYSFRTRSDRVSFRSTHSDGIIKLITHAL 123 EFY++ T + H DG+++ +T +L Sbjct: 436 EFYAWLTYPWQTQILRLHLDGVVEDVTESL 465 >SPACUNK4.10 |||hydroxyacid dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 334 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 158 RTRMRKFFLGIFNACVISLMIPS 90 RT KF++GIF+ +I + PS Sbjct: 58 RTYNSKFYMGIFDKEIIDNLPPS 80 >SPAC16A10.07c |taz1|myb1, myb|human TRF ortholog Taz1|Schizosaccharomyces pombe|chr 1|||Manual Length = 663 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 10 RRSRGRPYEFYSFRTR 57 RRS+G PYE Y R + Sbjct: 545 RRSQGNPYEGYRTRRK 560 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,033,082 Number of Sequences: 5004 Number of extensions: 17248 Number of successful extensions: 43 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 2,362,478 effective HSP length: 62 effective length of database: 2,052,230 effective search space used: 67723590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -