BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0355 (771 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 81 1e-15 SB_1641| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 79 5e-15 SB_38587| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_9170| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 7e-15 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 78 7e-15 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 7e-15 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 78 7e-15 SB_13220| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 7e-15 SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 7e-15 SB_59174| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_36790| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_30562| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_34299| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_33362| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_7317| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 77 2e-14 SB_34022| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_33552| Best HMM Match : MIF (HMM E-Value=9.7) 77 2e-14 SB_13755| Best HMM Match : Cyto_ox_2 (HMM E-Value=5.5e-09) 77 2e-14 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 76 3e-14 SB_42207| Best HMM Match : Ank (HMM E-Value=6.3) 76 3e-14 SB_41480| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_38636| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 76 3e-14 SB_33616| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_31742| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_26344| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 76 3e-14 SB_11590| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_59544| Best HMM Match : Secretin_N_2 (HMM E-Value=7.9) 76 3e-14 SB_59049| Best HMM Match : NUMOD1 (HMM E-Value=6) 76 3e-14 SB_56976| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 76 3e-14 SB_55903| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_55293| Best HMM Match : Hemopexin (HMM E-Value=6.7) 76 3e-14 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 76 3e-14 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_50168| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_41348| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_40846| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_38671| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_36182| Best HMM Match : Fic (HMM E-Value=2.3e-19) 76 3e-14 SB_35762| Best HMM Match : Beta-lactamase (HMM E-Value=7.2e-05) 76 3e-14 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_24533| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 76 3e-14 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 76 3e-14 SB_18725| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_17826| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_16932| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_16803| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_14402| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_14049| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_10480| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_10241| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_9002| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_3366| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 71 8e-13 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 71 8e-13 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 71 8e-13 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 71 8e-13 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 71 8e-13 SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) 71 8e-13 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 71 8e-13 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 69 3e-12 SB_52226| Best HMM Match : Cytadhesin_P30 (HMM E-Value=9) 58 1e-08 SB_46539| Best HMM Match : Keratin_B2 (HMM E-Value=1.2) 58 1e-08 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 58 1e-08 SB_56823| Best HMM Match : Rhabdo_NV (HMM E-Value=7.4) 56 4e-08 SB_54715| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) 56 4e-08 SB_50679| Best HMM Match : Tombus_P19 (HMM E-Value=2.1) 56 4e-08 SB_35269| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_33473| Best HMM Match : GST_N (HMM E-Value=0.028) 56 4e-08 SB_8585| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_4893| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_40844| Best HMM Match : DUF595 (HMM E-Value=6.1) 56 4e-08 SB_38057| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_26734| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_7597| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_5601| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_13397| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) 43 2e-04 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 40 0.002 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 40 0.002 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 40 0.002 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 40 0.002 SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) 40 0.002 SB_24687| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_6708| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 40 0.003 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20596| Best HMM Match : DUF1237 (HMM E-Value=6.4) 40 0.003 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 39 0.004 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_29655| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 39 0.004 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 39 0.004 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 39 0.005 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 39 0.005 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_20517| Best HMM Match : Nuclease_act (HMM E-Value=1.4) 39 0.005 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 39 0.005 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 38 0.007 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 38 0.007 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 38 0.007 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 38 0.007 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 38 0.007 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 38 0.007 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 38 0.007 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 38 0.007 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 38 0.007 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 38 0.007 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 38 0.007 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 38 0.007 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 38 0.007 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.007 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 38 0.007 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 38 0.007 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 38 0.007 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 38 0.007 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 38 0.007 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 38 0.007 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 38 0.007 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 38 0.007 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 38 0.007 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 38 0.007 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.007 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 38 0.007 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.007 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 38 0.007 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 38 0.007 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.007 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 38 0.007 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 38 0.007 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 38 0.007 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 38 0.007 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 38 0.007 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 38 0.007 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 38 0.007 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.007 SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 38 0.007 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 38 0.007 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 38 0.007 SB_27070| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 38 0.007 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_18568| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.5e-22) 38 0.007 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 38 0.007 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 38 0.007 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 38 0.007 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 38 0.007 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) 38 0.007 SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05) 38 0.007 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_8821| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_6860| Best HMM Match : zf-C3HC4 (HMM E-Value=0.14) 38 0.007 SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 38 0.007 SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) 38 0.007 SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) 38 0.007 SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3) 38 0.007 SB_3948| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34775| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_6296| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35192| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_47936| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_36829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_34540| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_13778| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_13484| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 37 0.016 SB_7483| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_731| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_16331| Best HMM Match : MCPsignal (HMM E-Value=0.036) 37 0.016 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 37 0.021 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_41802| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_32513| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_32393| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 37 0.021 SB_24699| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_15282| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_2276| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 37 0.021 SB_59347| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 37 0.021 SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) 37 0.021 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 37 0.021 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 37 0.021 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 36 0.027 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 36 0.027 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_32717| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 36 0.027 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 36 0.036 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 36 0.036 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 36 0.036 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 36 0.036 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 36 0.048 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 36 0.048 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 36 0.048 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 36 0.048 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 36 0.048 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 36 0.048 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 36 0.048 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 36 0.048 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 36 0.048 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 36 0.048 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 36 0.048 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 36 0.048 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 36 0.048 SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) 36 0.048 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 36 0.048 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 36 0.048 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 36 0.048 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 36 0.048 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 36 0.048 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 36 0.048 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 36 0.048 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 36 0.048 SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 36 0.048 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 36 0.048 SB_29112| Best HMM Match : Mucin (HMM E-Value=1.7) 36 0.048 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 36 0.048 SB_26142| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_18550| Best HMM Match : DUF987 (HMM E-Value=4.4) 36 0.048 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 36 0.048 SB_16872| Best HMM Match : ARM_1 (HMM E-Value=0) 36 0.048 SB_9530| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 36 0.048 SB_6524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_3169| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 35 0.063 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 35 0.063 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 35 0.063 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 35 0.063 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 35 0.063 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 35 0.063 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 35 0.063 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 35 0.063 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7) 35 0.063 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 80.6 bits (190), Expect = 1e-15 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +2 Query: 533 ITTGRGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 ITT GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 94 ITTWTGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 130 >SB_1641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 79.0 bits (186), Expect = 4e-15 Identities = 40/57 (70%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = +2 Query: 476 YRLNTACTETCWLNL*DKHITTGR-GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 +RL C L D IT R GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 35 FRLQKICDTQAVL---DNEITHHRQGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 88 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 78.6 bits (185), Expect = 5e-15 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 533 ITTGRGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 I++ GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 204 ISSSNGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 240 >SB_38587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 78.6 bits (185), Expect = 5e-15 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +2 Query: 542 GRGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 G GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 121 GNGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 154 >SB_9170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 78.2 bits (184), Expect = 7e-15 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 545 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 41 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 73 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 78.2 bits (184), Expect = 7e-15 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 545 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 105 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 137 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 78.2 bits (184), Expect = 7e-15 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +2 Query: 542 GRGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 G GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 126 GTGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 159 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 78.2 bits (184), Expect = 7e-15 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 545 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 216 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 248 >SB_13220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 78.2 bits (184), Expect = 7e-15 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +2 Query: 536 TTGRGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 TT GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 47 TTTVGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 82 >SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 78.2 bits (184), Expect = 7e-15 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 545 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 153 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 185 >SB_59174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 77.4 bits (182), Expect = 1e-14 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +2 Query: 542 GRGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 G GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 27 GVGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 60 >SB_36790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.0 bits (181), Expect = 2e-14 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 545 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 +GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 25 KGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 57 >SB_30562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 77.0 bits (181), Expect = 2e-14 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 545 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 +GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 64 KGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 96 >SB_34299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 77.0 bits (181), Expect = 2e-14 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 545 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 +GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 56 KGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 88 >SB_33362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 77.0 bits (181), Expect = 2e-14 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 545 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 +GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 114 KGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 146 >SB_7317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 77.0 bits (181), Expect = 2e-14 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA*SVKPGVPNE 673 GYRARI NH SC LCEIVIRS FHTTY+PEA SVKPGVPNE Sbjct: 48 GYRARILNHDLSCVLCEIVIRSVFHTTYDPEAESVKPGVPNE 89 >SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 77.0 bits (181), Expect = 2e-14 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 545 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 +GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 655 KGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 687 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 76.6 bits (180), Expect = 2e-14 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 545 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 +GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 132 QGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 164 >SB_34022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 76.6 bits (180), Expect = 2e-14 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 530 HITTGRGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 +++ GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 92 NLSKNLGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 129 >SB_33552| Best HMM Match : MIF (HMM E-Value=9.7) Length = 148 Score = 76.6 bits (180), Expect = 2e-14 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 545 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 +GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 116 QGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 148 >SB_13755| Best HMM Match : Cyto_ox_2 (HMM E-Value=5.5e-09) Length = 194 Score = 76.6 bits (180), Expect = 2e-14 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 545 RGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 +GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 162 QGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 194 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 110 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 141 >SB_42207| Best HMM Match : Ank (HMM E-Value=6.3) Length = 71 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 40 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 71 >SB_41480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 74 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 105 >SB_38636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 45 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 76 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 112 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 143 >SB_33616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 56 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 87 >SB_31742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 41 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 72 >SB_26344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 75 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 106 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 187 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 218 >SB_11590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 70 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 101 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 124 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 155 >SB_59544| Best HMM Match : Secretin_N_2 (HMM E-Value=7.9) Length = 158 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 127 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 158 >SB_59049| Best HMM Match : NUMOD1 (HMM E-Value=6) Length = 77 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 46 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 77 >SB_56976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 71 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 102 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 169 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 200 >SB_55903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 58 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 89 >SB_55293| Best HMM Match : Hemopexin (HMM E-Value=6.7) Length = 64 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 33 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 64 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 164 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 195 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 160 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 191 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 136 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 167 >SB_50168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 72 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 103 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 193 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 224 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 149 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 180 >SB_41348| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 10 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 41 >SB_40846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 57 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 88 >SB_38671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 36 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 67 >SB_36182| Best HMM Match : Fic (HMM E-Value=2.3e-19) Length = 181 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 150 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 181 >SB_35762| Best HMM Match : Beta-lactamase (HMM E-Value=7.2e-05) Length = 166 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 135 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 166 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 121 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 152 >SB_24533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 30 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 61 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 109 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 140 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 126 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 157 >SB_18725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 74 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 105 >SB_17826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 68 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 99 >SB_16932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 35 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 66 >SB_16803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 16 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 47 >SB_14402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 25 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 56 >SB_14049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 99 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 130 >SB_10480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 29 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 60 >SB_10241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 124 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 155 >SB_9002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 41 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 72 >SB_3366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 76.2 bits (179), Expect = 3e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 80 GYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 111 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) Length = 996 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) Length = 183 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) Length = 336 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 MSELTHINCVALTARFPVGKPVVPAALMNRP+ G Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRG 34 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 69.3 bits (162), Expect = 3e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +3 Query: 537 LLAGGTELEFVIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 ++ GTELEFVIMVIAVS VKLLSAHNSTQHTSRKHKV Sbjct: 148 IILSGTELEFVIMVIAVSCVKLLSAHNSTQHTSRKHKV 185 >SB_52226| Best HMM Match : Cytadhesin_P30 (HMM E-Value=9) Length = 264 Score = 57.6 bits (133), Expect = 1e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 VIMVIAVS+VKLLSAHNSTQHTSRKHKV Sbjct: 237 VIMVIAVSYVKLLSAHNSTQHTSRKHKV 264 >SB_46539| Best HMM Match : Keratin_B2 (HMM E-Value=1.2) Length = 300 Score = 57.6 bits (133), Expect = 1e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 VIMVIAVS+VKLLSAHNSTQHTSRKHKV Sbjct: 273 VIMVIAVSYVKLLSAHNSTQHTSRKHKV 300 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 57.6 bits (133), Expect = 1e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +2 Query: 548 GYRARIRNHGHSCFLCEIVIRSQF 619 GYRARIRNHGHSCFLCEIVIRSQF Sbjct: 258 GYRARIRNHGHSCFLCEIVIRSQF 281 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 619 PHNIRAGSIKCKAWGA 666 PHNIRAGSIKCKAWGA Sbjct: 282 PHNIRAGSIKCKAWGA 297 >SB_56823| Best HMM Match : Rhabdo_NV (HMM E-Value=7.4) Length = 157 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 VIMVIAVS VKLLSAHNSTQHTSRKHKV Sbjct: 130 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 157 >SB_54715| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) Length = 1143 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 VIMVIAVS VKLLSAHNSTQHTSRKHKV Sbjct: 1116 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 1143 >SB_50679| Best HMM Match : Tombus_P19 (HMM E-Value=2.1) Length = 330 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 VIMVIAVS VKLLSAHNSTQHTSRKHKV Sbjct: 303 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 330 >SB_35269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 VIMVIAVS VKLLSAHNSTQHTSRKHKV Sbjct: 145 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 172 >SB_33473| Best HMM Match : GST_N (HMM E-Value=0.028) Length = 276 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 VIMVIAVS VKLLSAHNSTQHTSRKHKV Sbjct: 249 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 276 >SB_8585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 VIMVIAVS VKLLSAHNSTQHTSRKHKV Sbjct: 211 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 238 >SB_4893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 VIMVIAVS VKLLSAHNSTQHTSRKHKV Sbjct: 255 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 282 >SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 VIMVIAVS VKLLSAHNSTQHTSRKHKV Sbjct: 229 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 256 >SB_40844| Best HMM Match : DUF595 (HMM E-Value=6.1) Length = 194 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 VIMVIAVS VKLLSAHNSTQHTSRKHKV Sbjct: 167 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 194 >SB_38057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 VIMVIAVS VKLLSAHNSTQHTSRKHKV Sbjct: 176 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 203 >SB_26734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 VIMVIAVS VKLLSAHNSTQHTSRKHKV Sbjct: 123 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 150 >SB_7597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV 650 VIMVIAVS VKLLSAHNSTQHTSRKHKV Sbjct: 181 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 208 >SB_5601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 54.4 bits (125), Expect = 1e-07 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = +2 Query: 524 DKHITT-GRGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 643 +KH+ G Y+ARIRNHG C+ E VIRS FHTTYEPEA Sbjct: 95 NKHVADKGLLYQARIRNHGPICYQRETVIRSLFHTTYEPEA 135 >SB_13397| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 513 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 740 WHDRFPDWKAGSERNAINVS 681 WHDRFPDWKAGSERNAINV+ Sbjct: 190 WHDRFPDWKAGSERNAINVA 209 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 127 DVVAVSQAPSPESNPDSPLPVTTM 198 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) Length = 300 Score = 43.2 bits (97), Expect = 2e-04 Identities = 26/59 (44%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Frame = +3 Query: 603 LSAHNSTQHTSRKHKV*SLGCLMSE---LTHINCVALTARFPVGKPVVPAALMNRPSAG 770 +S + QH S KHK + GC E + + T VGKPVVPAALMNRP+ G Sbjct: 155 ISGEYAVQH-SCKHKAFTEGCKEPEGPKHRYFRRICCTTLLQVGKPVVPAALMNRPTRG 212 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +3 Query: 657 LGCLMSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 L C+ S++ I+ V L PVGKPVVPAALMNRP+ G Sbjct: 22 LNCVPSKIKLIDTVDLEGG-PVGKPVVPAALMNRPTRG 58 >SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = +3 Query: 693 CVALTARFPVGKPVVPAALMNRPSAG 770 C++ T F VGKPVVPAALMNRP+ G Sbjct: 129 CISFTRIFRVGKPVVPAALMNRPTRG 154 >SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 41.9 bits (94), Expect = 6e-04 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 1/50 (2%) Frame = +3 Query: 624 QHTSRKHKV*S-LGCLMSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 +H +RK K+ S L M ++ I+ V L PVGKPVVPAALMNRP+ G Sbjct: 102 EHKTRKTKLLSTLPPRMRKIKLIDTVDLEGG-PVGKPVVPAALMNRPTRG 150 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/30 (56%), Positives = 23/30 (76%) Frame = +3 Query: 681 THINCVALTARFPVGKPVVPAALMNRPSAG 770 T +C+ ++ + VGKPVVPAALMNRP+ G Sbjct: 27 TGFHCILVSFGYSVGKPVVPAALMNRPTRG 56 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 136 AVSQAPSPESNPDSPLPVTTM 198 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 40.7 bits (91), Expect = 0.001 Identities = 28/61 (45%), Positives = 33/61 (54%) Frame = +3 Query: 588 SFVKLLSAHNSTQHTSRKHKV*SLGCLMSELTHINCVALTARFPVGKPVVPAALMNRPSA 767 S K+L H T R+ G L E+ I+ V L PVGKPVVPAALMNRP+ Sbjct: 38 SIDKVLGGHVLTYRLFRRDLA---GKLHIEIKLIDTVDLEGG-PVGKPVVPAALMNRPTR 93 Query: 768 G 770 G Sbjct: 94 G 94 >SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/36 (58%), Positives = 25/36 (69%) Frame = +3 Query: 663 CLMSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 C+ S + I+ V L PVGKPVVPAALMNRP+ G Sbjct: 19 CMKSVIKLIDTVDLEGG-PVGKPVVPAALMNRPTRG 53 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/35 (57%), Positives = 24/35 (68%) Frame = +3 Query: 666 LMSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 +M + + VA AR VGKPVVPAALMNRP+ G Sbjct: 208 IMKKSGSVQIVAELAREYVGKPVVPAALMNRPTRG 242 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 590 GNSYDHDYEFELGTPCQ 540 GNSYDHDYEFELGTP Q Sbjct: 17 GNSYDHDYEFELGTPRQ 33 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 590 GNSYDHDYEFELGTPC 543 GNSYDHDYEFELGT C Sbjct: 17 GNSYDHDYEFELGTQC 32 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 699 ALTARFPVGKPVVPAALMNRPSAG 770 A+ P+GKPVVPAALMNRP+ G Sbjct: 173 AINTTLPIGKPVVPAALMNRPTRG 196 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 590 GNSYDHDYEFELGTPC 543 GNSYDHDYEFELGT C Sbjct: 17 GNSYDHDYEFELGTQC 32 >SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) Length = 753 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +3 Query: 711 RFPVGKPVVPAALMNRPSAG 770 R P+GKPVVPAALMNRP+ G Sbjct: 212 RIPIGKPVVPAALMNRPTRG 231 >SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) Length = 145 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/47 (46%), Positives = 28/47 (59%) Frame = +3 Query: 630 TSRKHKV*SLGCLMSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 TSR+ L L++ ++ T R VGKPVVPAALMNRP+ G Sbjct: 11 TSREFADMQLNPLVAHTILVHARTKTERTLVGKPVVPAALMNRPTRG 57 >SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) Length = 900 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +3 Query: 660 GCLMSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 G L + + + +T + VGKPVVPAALMNRP+ G Sbjct: 826 GALPEVIESLPRIKITTQHTVGKPVVPAALMNRPTRG 862 >SB_24687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 590 GNSYDHDYEFELGTP 546 GNSYDHDYEFELGTP Sbjct: 17 GNSYDHDYEFELGTP 31 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/55 (43%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +3 Query: 612 HNSTQHTSRKHKV*SLGCLMSELTHINCVALT--ARFPVGKPVVPAALMNRPSAG 770 +N T+H R V S+ T I + PVGKPVVPAALMNRP+ G Sbjct: 4 YNCTRHIERNAAVSSIDNAKKIDTSIKLIDTVDLEGGPVGKPVVPAALMNRPTRG 58 >SB_6708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 590 GNSYDHDYEFELGTP 546 GNSYDHDYEFELGTP Sbjct: 17 GNSYDHDYEFELGTP 31 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 590 GNSYDHDYEFELGTP 546 GNSYDHDYEFELGTP Sbjct: 17 GNSYDHDYEFELGTP 31 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 590 GNSYDHDYEFELGTP 546 GNSYDHDYEFELGTP Sbjct: 17 GNSYDHDYEFELGTP 31 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 590 GNSYDHDYEFELGTP 546 GNSYDHDYEFELGTP Sbjct: 17 GNSYDHDYEFELGTP 31 >SB_20596| Best HMM Match : DUF1237 (HMM E-Value=6.4) Length = 526 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 590 GNSYDHDYEFELGTP 546 GNSYDHDYEFELGTP Sbjct: 163 GNSYDHDYEFELGTP 177 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 5/33 (15%) Frame = +3 Query: 687 INCVALTARF-----PVGKPVVPAALMNRPSAG 770 + C+A R+ P+GKPVVPAALMNRP+ G Sbjct: 58 VRCIAEGGRYKKNVSPIGKPVVPAALMNRPTRG 90 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/39 (53%), Positives = 26/39 (66%) Frame = +3 Query: 654 SLGCLMSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 S+ C + + I+ V L PVGKPVVPAALMNRP+ G Sbjct: 36 SIDCETAIIKLIDTVDLEGG-PVGKPVVPAALMNRPTRG 73 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = +3 Query: 714 FPVGKPVVPAALMNRPSAG 770 +P+GKPVVPAALMNRP+ G Sbjct: 71 YPIGKPVVPAALMNRPTRG 89 >SB_29655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 590 GNSYDHDYEFELGTPC 543 GNSYDHDYEFELGT C Sbjct: 17 GNSYDHDYEFELGTLC 32 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 708 ARFPVGKPVVPAALMNRPSAG 770 A F VGKPVVPAALMNRP+ G Sbjct: 106 AEFSVGKPVVPAALMNRPTRG 126 >SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) Length = 488 Score = 39.1 bits (87), Expect = 0.004 Identities = 28/75 (37%), Positives = 34/75 (45%) Frame = +3 Query: 546 GGTELEFVIMVIAVSFVKLLSAHNSTQHTSRKHKV*SLGCLMSELTHINCVALTARFPVG 725 G LE +I F + +K S G L + I+ V L PVG Sbjct: 327 GENPLELADELILYGFANRNGRFYKNRCIKKKDLPVSYGGLHYRIKLIDTVDLEGG-PVG 385 Query: 726 KPVVPAALMNRPSAG 770 KPVVPAALMNRP+ G Sbjct: 386 KPVVPAALMNRPTRG 400 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 666 LMSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 L+S + I+ V L PVGKPVVPAALMNRP+ G Sbjct: 97 LLSLIKLIDTVDLEGG-PVGKPVVPAALMNRPTRG 130 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/34 (58%), Positives = 25/34 (73%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 +S++ I+ V L PVGKPVVPAALMNRP+ G Sbjct: 71 VSDIKLIDTVDLEGG-PVGKPVVPAALMNRPTRG 103 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 38.7 bits (86), Expect = 0.005 Identities = 26/65 (40%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = +3 Query: 582 AVSFVKLLSAHNSTQHTSRKHKV*SLGCL--MSELTHINCVALTARFPVGKPVVPAALMN 755 A F+K+ N HK+ C + + I+ V L PVGKPVVPAALMN Sbjct: 245 AKPFIKVTKV-NQAADCFTDHKLLMSNCAFPLKRIKLIDTVDLEGG-PVGKPVVPAALMN 302 Query: 756 RPSAG 770 RP+ G Sbjct: 303 RPTRG 307 >SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/34 (58%), Positives = 25/34 (73%) Frame = +3 Query: 669 MSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 +S++ I+ V L PVGKPVVPAALMNRP+ G Sbjct: 111 ISQIKLIDTVDLEGG-PVGKPVVPAALMNRPTRG 143 >SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = +3 Query: 681 THINCVALTARFPVGKPVVPAALMNRPSAG 770 T + C R +GKPVVPAALMNRP+ G Sbjct: 90 TCLRCSRFHQRLKLGKPVVPAALMNRPTRG 119 >SB_20517| Best HMM Match : Nuclease_act (HMM E-Value=1.4) Length = 123 Score = 38.7 bits (86), Expect = 0.005 Identities = 28/61 (45%), Positives = 35/61 (57%) Frame = +3 Query: 588 SFVKLLSAHNSTQHTSRKHKV*SLGCLMSELTHINCVALTARFPVGKPVVPAALMNRPSA 767 S VK+LS +N + KV G + + I+ V L PVGKPVVPAALMNRP+ Sbjct: 33 SLVKMLSRNNVLE------KV-VFGSMKDYIKLIDTVDLEGG-PVGKPVVPAALMNRPTR 84 Query: 768 G 770 G Sbjct: 85 G 85 >SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) Length = 568 Score = 38.7 bits (86), Expect = 0.005 Identities = 27/68 (39%), Positives = 38/68 (55%) Frame = +3 Query: 567 VIMVIAVSFVKLLSAHNSTQHTSRKHKV*SLGCLMSELTHINCVALTARFPVGKPVVPAA 746 V++ A F L + NS ++ + ++GC+ I+ V L PVGKPVVPAA Sbjct: 420 VVVYRAAVFAAL--SGNSDSTIRARYAMIAIGCIKL----IDTVDLEGG-PVGKPVVPAA 472 Query: 747 LMNRPSAG 770 LMNRP+ G Sbjct: 473 LMNRPTRG 480 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 112 PVGKPVVPAALMNRPTRG 129 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 37 PVGKPVVPAALMNRPTRG 54 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 134 PVGKPVVPAALMNRPTRG 151 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 236 PVGKPVVPAALMNRPTRG 253 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 56 PVGKPVVPAALMNRPTRG 73 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 61 PVGKPVVPAALMNRPTRG 78 >SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) Length = 187 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 132 PVGKPVVPAALMNRPTRG 149 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 50 PVGKPVVPAALMNRPTRG 67 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 146 PVGKPVVPAALMNRPTRG 163 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 43 PVGKPVVPAALMNRPTRG 60 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 33 PVGKPVVPAALMNRPTRG 50 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 333 PVGKPVVPAALMNRPTRG 350 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 88 PVGKPVVPAALMNRPTRG 105 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 74 PVGKPVVPAALMNRPTRG 91 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 307 PVGKPVVPAALMNRPTRG 324 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 108 PVGKPVVPAALMNRPTRG 125 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 34 PVGKPVVPAALMNRPTRG 51 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 468 PVGKPVVPAALMNRPTRG 485 >SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 28 PVGKPVVPAALMNRPTRG 45 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 93 PVGKPVVPAALMNRPTRG 110 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 53 PVGKPVVPAALMNRPTRG 70 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 154 PVGKPVVPAALMNRPTRG 171 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 53 PVGKPVVPAALMNRPTRG 70 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 37 PVGKPVVPAALMNRPTRG 54 >SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) Length = 216 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 161 PVGKPVVPAALMNRPTRG 178 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 57 PVGKPVVPAALMNRPTRG 74 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 79 PVGKPVVPAALMNRPTRG 96 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +3 Query: 660 GCLMSELTHINCVALTARFPVGKPVVPAALMNRPSAG 770 G LM ++ C+ GKPVVPAALMNRP+ G Sbjct: 26 GVLMFVISFSGCLGALRENVFGKPVVPAALMNRPTRG 62 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 17 PVGKPVVPAALMNRPTRG 34 >SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 56 PVGKPVVPAALMNRPTRG 73 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 39 PVGKPVVPAALMNRPTRG 56 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 37 PVGKPVVPAALMNRPTRG 54 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 78 PVGKPVVPAALMNRPTRG 95 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 24 PVGKPVVPAALMNRPTRG 41 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 134 PVGKPVVPAALMNRPTRG 151 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 92 PVGKPVVPAALMNRPTRG 109 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 33 PVGKPVVPAALMNRPTRG 50 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 36 PVGKPVVPAALMNRPTRG 53 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 232 PVGKPVVPAALMNRPTRG 249 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 135 PVGKPVVPAALMNRPTRG 152 >SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 28 PVGKPVVPAALMNRPTRG 45 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 744 PVGKPVVPAALMNRPTRG 761 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 37 PVGKPVVPAALMNRPTRG 54 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 134 PVGKPVVPAALMNRPTRG 151 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 95 PVGKPVVPAALMNRPTRG 112 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 219 PVGKPVVPAALMNRPTRG 236 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 45 PVGKPVVPAALMNRPTRG 62 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 53 PVGKPVVPAALMNRPTRG 70 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 1673 PVGKPVVPAALMNRPTRG 1690 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 95 PVGKPVVPAALMNRPTRG 112 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 63 PVGKPVVPAALMNRPTRG 80 >SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) Length = 409 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 107 PVGKPVVPAALMNRPTRG 124 >SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 93 PVGKPVVPAALMNRPTRG 110 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 32 PVGKPVVPAALMNRPTRG 49 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 41 PVGKPVVPAALMNRPTRG 58 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 935 PVGKPVVPAALMNRPTRG 952 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 82 PVGKPVVPAALMNRPTRG 99 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 415 PVGKPVVPAALMNRPTRG 432 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 97 PVGKPVVPAALMNRPTRG 114 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 70 PVGKPVVPAALMNRPTRG 87 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 85 PVGKPVVPAALMNRPTRG 102 >SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) Length = 197 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 142 PVGKPVVPAALMNRPTRG 159 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 111 PVGKPVVPAALMNRPTRG 128 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 47 PVGKPVVPAALMNRPTRG 64 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 40 PVGKPVVPAALMNRPTRG 57 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 70 PVGKPVVPAALMNRPTRG 87 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 61 PVGKPVVPAALMNRPTRG 78 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 38 PVGKPVVPAALMNRPTRG 55 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 31 PVGKPVVPAALMNRPTRG 48 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 84 PVGKPVVPAALMNRPTRG 101 >SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 717 PVGKPVVPAALMNRPSAG 770 PVGKPVVPAALMNRP+ G Sbjct: 62 PVGKPVVPAALMNRPTRG 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,127,860 Number of Sequences: 59808 Number of extensions: 549835 Number of successful extensions: 2281 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2279 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -