BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0355 (771 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 3.1 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 4.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.5 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 7.3 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -1 Query: 624 VWNCERITISQRKQL*P*LRIRARYPL 544 +WN I++ R+ + +R +RYPL Sbjct: 99 LWNFPMISVFSRQDIETIIRRNSRYPL 125 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.6 bits (46), Expect = 4.2 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -2 Query: 506 MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 372 M C P DT +Y+F R Y + T VI + + TLT Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 128 SKEGSRRANYPLPARGGSDEK*RYG 54 +K S+ AN P PA GG + + G Sbjct: 1014 AKPQSQEANKPKPATGGKGTRPKRG 1038 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 7.3 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 315 PKSLILMNLDNFCRSHG 265 P+ L +NL + CR HG Sbjct: 430 PRELEAVNLGSACRIHG 446 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 224,025 Number of Sequences: 438 Number of extensions: 4797 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -