BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0354 (511 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1178 + 11178430-11178547,11179781-11179864,11179960-111800... 28 5.0 03_06_0727 - 35766252-35766481,35766592-35766721,35767049-357671... 28 5.0 10_05_0041 - 8469769-8470164 27 6.6 07_03_0626 + 20060013-20060273,20061017-20061274 27 6.6 07_03_0414 + 17892133-17893590 27 6.6 01_06_0347 + 28592552-28593502 27 8.8 01_06_0091 - 26363070-26363361,26363467-26363625,26363708-263638... 27 8.8 >07_01_1178 + 11178430-11178547,11179781-11179864,11179960-11180001, 11180101-11180148,11180437-11180520,11180609-11180668, 11180745-11180792,11180899-11180984 Length = 189 Score = 27.9 bits (59), Expect = 5.0 Identities = 21/61 (34%), Positives = 30/61 (49%) Frame = +1 Query: 271 SRSLLMGEQSNAWRNKLRNDRKSRHRRIKKQRRYERLAGTSQLSLWSFSGTSGQKLWILQ 450 S L M ++ K + +KS+ +I KQ + AGTS S+ S SGT + L I Sbjct: 49 SNVLKMADEKQFEAGKTSSGKKSQGLKIMKQLAGKIEAGTSTNSVNSKSGTEEKILKISN 108 Query: 451 D 453 D Sbjct: 109 D 109 >03_06_0727 - 35766252-35766481,35766592-35766721,35767049-35767116, 35767179-35767217,35767677-35767761,35768097-35768197, 35768292-35768511 Length = 290 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 212 DSNTAQYERNRSFGHLVHARLRASGGAKLPS 120 D+N A+ ++ +SF HLV R S +K P+ Sbjct: 164 DTNKAEEQQLKSFAHLVFPNSRKSASSKEPN 194 >10_05_0041 - 8469769-8470164 Length = 131 Score = 27.5 bits (58), Expect = 6.6 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +1 Query: 268 SSRSLLMGEQSNAWRNKLRNDRKSRHRRIKKQRRYERLAGTSQLSLWSFSGT 423 SS ++ GE+ W++ LR+D K++ R ++ ER G S+L W + T Sbjct: 43 SSTTIDDGERRR-WQDGLRDDLKNKMREVR-----EREGGRSELGRWPKAAT 88 >07_03_0626 + 20060013-20060273,20061017-20061274 Length = 172 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 74 RLGWLRP*RRSGIIP 118 RLGWLRP R S ++P Sbjct: 32 RLGWLRPSRLSAVVP 46 >07_03_0414 + 17892133-17893590 Length = 485 Score = 27.5 bits (58), Expect = 6.6 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +2 Query: 254 HGLNPAHVPF*WVNNPTL-GETSFAMIGRADIEGSKSNVAMNAWLAQ 391 HGL A PF WV P + G + A + A KS + W Q Sbjct: 305 HGLVAAGYPFLWVLRPDMVGASQSAALREAVAAAGKSKARVVEWAPQ 351 >01_06_0347 + 28592552-28593502 Length = 316 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 476 DCESTAYRSCSIQSFWPEVPEKDHRDNWL 390 DC S ++C WP++P + NWL Sbjct: 238 DCGSCGKKAC----MWPQIPNEKREINWL 262 >01_06_0091 - 26363070-26363361,26363467-26363625,26363708-26363880, 26366639-26366810,26366912-26367294 Length = 392 Score = 27.1 bits (57), Expect = 8.8 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +2 Query: 347 EGSKSNVAMNAWLAQASYPCGPFLAPLAKNSGYYRIDRPCF 469 EGS+S +A ++YP GP A A S + +P F Sbjct: 302 EGSRSCAQQTQPVAGSAYPAGPVPAQSAVRSAIAGMSKPVF 342 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,982,109 Number of Sequences: 37544 Number of extensions: 307685 Number of successful extensions: 755 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1095026320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -