BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0353 (482 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43122| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_9060| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_49251| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.87 SB_11863| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 1.5 SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) 28 3.5 SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.5 SB_55066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_51190| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_48072| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_47125| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_44926| Best HMM Match : Attractin (HMM E-Value=7) 28 3.5 SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.5 SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_43021| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_41868| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_41072| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.5 SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36156| Best HMM Match : Attractin (HMM E-Value=7) 28 3.5 SB_36112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_35086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.5 SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) 28 3.5 SB_32963| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_29844| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4) 28 3.5 SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_21728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) 28 3.5 SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 28 3.5 SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_17415| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_17306| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.5 SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 28 3.5 SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_9120| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_8797| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_8779| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_8654| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_8464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_8430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_8410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_8220| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_7764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_7356| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_7349| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_7252| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_7157| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_7113| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_7085| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_6890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_6616| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_6037| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_5934| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_5529| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_5295| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_5042| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_5041| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_4578| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_4511| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_4433| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_4372| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_4226| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_4161| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_3964| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_3933| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_2907| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_2782| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_2639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_2564| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_2174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_2150| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_1538| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_1504| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_1281| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_1196| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_788| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_721| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_574| Best HMM Match : PapG_N (HMM E-Value=8) 28 3.5 SB_548| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.5 SB_172| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_59785| Best HMM Match : TBCA (HMM E-Value=3) 28 3.5 SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_59546| Best HMM Match : Collagen (HMM E-Value=0.003) 28 3.5 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.5 SB_59242| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 28 3.5 SB_59187| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_59131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_59001| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_58964| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_58933| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_58264| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_57917| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_57878| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_57788| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_56857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_56810| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_56195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_56111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_55984| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_55672| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_55664| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_55372| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_55221| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_53956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_53701| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_53637| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_53434| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_53249| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_52930| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_52839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_52708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_52332| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_52026| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_51920| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_51767| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_51579| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_51510| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.5 SB_51154| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_50997| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_50427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_50404| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) 28 3.5 SB_50393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_50189| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_49781| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_49101| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_49042| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_48963| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_48957| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_48813| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_48453| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_48226| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_47917| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_47720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_47666| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_47427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_47350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_46769| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_46630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_46329| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_46320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_46081| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_45834| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_45450| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_45197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_45018| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_44709| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_44370| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) 28 3.5 SB_44174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_44053| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_43619| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_43572| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_43409| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_42784| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_42287| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_42013| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.8) 28 3.5 SB_41701| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_41333| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_41310| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_41155| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_41098| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_40781| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_40467| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_40329| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_40185| Best HMM Match : WD40 (HMM E-Value=0) 28 3.5 SB_40150| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_40121| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.5 SB_40085| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_39869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_39718| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_39341| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_38615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_38278| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_37993| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_37765| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_37658| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_37587| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_37564| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_37354| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_37287| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_37073| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36965| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36882| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36725| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36717| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36657| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36525| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36394| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_36031| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_35815| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_35712| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_35515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_35475| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_35434| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_35346| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_35321| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_34616| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_34440| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_34397| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_34379| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_34378| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_34023| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_33989| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_33474| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_33416| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_33328| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_33170| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_32512| Best HMM Match : Chlam_OMP3 (HMM E-Value=4.2) 28 3.5 SB_32361| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_32275| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_32014| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_31990| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_31973| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_31926| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_31716| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_31547| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_31521| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_30243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_30141| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_29925| Best HMM Match : GYF (HMM E-Value=6.8) 28 3.5 SB_29531| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_29169| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_28227| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_28224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_27489| Best HMM Match : Pep_M12B_propep (HMM E-Value=4.7) 28 3.5 SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 28 3.5 SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_26909| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_26861| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 28 3.5 SB_26658| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_25285| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_25254| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_25043| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_24889| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_24879| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_24857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_24789| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_24551| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_24500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_24211| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_23617| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_23470| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_23311| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_23121| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_22956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_22358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_22112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.5 SB_21855| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_21849| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_21590| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_21571| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 >SB_43122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 46.4 bits (105), Expect = 1e-05 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +2 Query: 20 KIRQALDCSPIKRERELGLDRRET 91 +IRQ LDCSP RERELGLDRRET Sbjct: 26 RIRQVLDCSPTNRERELGLDRRET 49 >SB_9060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 46.4 bits (105), Expect = 1e-05 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +2 Query: 20 KIRQALDCSPIKRERELGLDRRET 91 +IRQ LDCSP RERELGLDRRET Sbjct: 11 RIRQVLDCSPTNRERELGLDRRET 34 >SB_49251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1560 Score = 30.3 bits (65), Expect = 0.87 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -1 Query: 443 SGLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDS 297 +G R R + DS ++DP G+RR++ F E R V L+ D+ Sbjct: 87 TGFRVRFPVPTEFMDSPPIKDPPGVRRKIEEFTIEQRAVNKRRLDLLDT 135 >SB_11863| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 921 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 237 PLRPKPPSRIRQGYAHCG 290 PLRPKPP+ I Y CG Sbjct: 256 PLRPKPPTFIFHNYGECG 273 >SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) Length = 196 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 2 WVNNPTLGEF 11 >SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 67 WVNNPTLGEF 76 >SB_55066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_51190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_48072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_47125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 40 WVNNPTLGEF 49 >SB_44926| Best HMM Match : Attractin (HMM E-Value=7) Length = 111 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_43021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 2 WVNNPTLGEF 11 >SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_41868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_41072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 70 WVNNPTLGEF 79 >SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_36156| Best HMM Match : Attractin (HMM E-Value=7) Length = 162 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_36112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 70 WVNNPTLGEF 79 >SB_35086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 40 WVNNPTLGEF 49 >SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) Length = 471 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 348 WVNNPTLGEF 357 >SB_32963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 2 WVNNPTLGEF 11 >SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 40 WVNNPTLGEF 49 >SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_29844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4) Length = 128 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 2 WVNNPTLGEF 11 >SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 2 WVNNPTLGEF 11 >SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_21728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 19 WVNNPTLGEF 28 >SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) Length = 128 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 153 WVNNPTLGEF 162 >SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 40 WVNNPTLGEF 49 >SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 70 WVNNPTLGEF 79 >SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 32 WVNNPTLGEF 41 >SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 70 WVNNPTLGEF 79 >SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 50 WVNNPTLGEF 21 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,971,222 Number of Sequences: 59808 Number of extensions: 335437 Number of successful extensions: 1513 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1513 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1013948003 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -