BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0353 (482 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g26190.1 68417.m03770 expressed protein 28 2.9 At2g36300.1 68415.m04455 integral membrane Yip1 family protein c... 27 8.8 >At4g26190.1 68417.m03770 expressed protein Length = 1067 Score = 28.3 bits (60), Expect = 2.9 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +3 Query: 345 FKTRDATSKPIWIAEIDAIGFFLNTCITAPKSGYN 449 FKT++ KP+++ ++ + + TCI+ K Y+ Sbjct: 944 FKTQEKKDKPLFLKDLRRVWDHIGTCISCGKRKYD 978 >At2g36300.1 68415.m04455 integral membrane Yip1 family protein contains Pfam domain, PF04893: Yip1 domain Length = 255 Score = 26.6 bits (56), Expect = 8.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 171 LVHALGRAAGGANYHPRDYA*TPLRPKPPS 260 +V G ++GGAN R + TP +P PS Sbjct: 10 VVFPSGGSSGGANVQQRRFPATPFQPPRPS 39 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,033,197 Number of Sequences: 28952 Number of extensions: 227840 Number of successful extensions: 552 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 829097472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -