BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0352 (597 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 3.0 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 3.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 3.0 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 5.3 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.2 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 456 RIQNARRDVEAHLDRGDRAIGFF 524 ++Q VEAHL +G AIG + Sbjct: 180 QLQGISTPVEAHLRKGRGAIGAY 202 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 Query: 488 PFGSRRSCYRFFS*HVHHGSEVRI*LSSMSGLGIV 592 P +R CY+ H+ S I + +S LGIV Sbjct: 494 PHEDKRGCYQLAINHIRWNSAFAIAPAVISCLGIV 528 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 Query: 488 PFGSRRSCYRFFS*HVHHGSEVRI*LSSMSGLGIV 592 P +R CY+ H+ S I + +S LGIV Sbjct: 584 PHEDKRGCYQLAINHIRWNSAFAIAPAVISCLGIV 618 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -2 Query: 320 RTTGRSAECMNQMSETAVPLVL 255 + G+ +C N MSE V ++L Sbjct: 170 KENGKEFDCHNYMSELTVDILL 191 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 207 LSHDGLIPAHVPF*WVNNPT 148 +SH + HVP W+ PT Sbjct: 694 VSHTQRLVVHVPPRWIVEPT 713 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,585 Number of Sequences: 438 Number of extensions: 3471 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -