BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0352 (597 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54020.2 68414.m06155 myrosinase-associated protein, putative... 28 4.1 At1g67970.1 68414.m07764 heat shock factor protein, putative (HS... 28 5.4 At3g23530.1 68416.m02961 cyclopropane fatty acid synthase, putat... 27 7.2 At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei... 27 7.2 At1g35510.1 68414.m04407 expressed protein contains Pfam PF03138... 27 9.5 At1g14740.1 68414.m01762 expressed protein 27 9.5 >At1g54020.2 68414.m06155 myrosinase-associated protein, putative strong similarity to myrosinase-associated proteins GI:1769968, GI:1769970, GI:1216389,GI:1216391 from [Brassica napus]; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 372 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +2 Query: 56 LACGSQAFIATLLFDPSMSALPIIANKDSPSVGLFT 163 + C S + + LL P + L I+ ++ P+VGLFT Sbjct: 1 MECSSVSVLGILLVFPLLHNLVTISGQNLPAVGLFT 36 >At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5) / heat shock transcription factor, putative (HSTF5) identical to heat shock transcription factor 5 (HSF5) SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 374 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +2 Query: 308 GRWCELPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQCD 439 G W +L +K + ++ + GKD LT+E E G+ + D Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329 >At3g23530.1 68416.m02961 cyclopropane fatty acid synthase, putative / CPA-FA synthase, putative similar to cyclopropane synthase [Sterculia foetida] GI:21069167; contains Pfam profiles PF02353: Cyclopropane-fatty-acyl-phospholipid synthase, PF01593: amine oxidase, flavin-containing Length = 867 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +3 Query: 459 IQNARRDVEAHLDRGDRAIGFFLNTCITAPKSGYNS 566 + ARR++ H D + GFFL+ +T + + S Sbjct: 569 LTQARRNISRHYDLSNELFGFFLDDTMTYSSAVFKS 604 >At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein / hsp20 family protein contains Pfam profile: PF00011 Hsp20/alpha crystallin family Length = 285 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 357 RPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR-RDVEAHLD 497 RPK P A + ++WSP S A + + +VA + A D+ +D Sbjct: 169 RPKLDLPKLANLGTVWSPRSNVAESTHSYVVAIELPGASINDIRVEVD 216 >At1g35510.1 68414.m04407 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'growth regulator protein -related' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497. Length = 568 Score = 27.1 bits (57), Expect = 9.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 114 ADIEGSKSNVAMNAWLPQ 61 AD+ GS NV M AW P+ Sbjct: 122 ADVNGSSHNVLMEAWKPR 139 >At1g14740.1 68414.m01762 expressed protein Length = 733 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +2 Query: 320 ELPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSK--QCDFTSRVSHSKRETRRRS 487 EL + LC N+ K SL + GK+++T S K + DF + + ++R++ Sbjct: 69 ELTLSYLCENSGKLAESLGQKGKEVVTFSENSSYDDKWVERDFFNLREMNPNSSKRKA 126 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,099,344 Number of Sequences: 28952 Number of extensions: 272248 Number of successful extensions: 681 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 681 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -