BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0350 (622 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0150 + 1191410-1191697,1191818-1191941,1192063-1192121,119... 28 5.2 12_01_0592 + 4848467-4849164,4849413-4849491 27 9.1 06_03_1183 + 28237467-28237612,28238035-28238089,28238216-282383... 27 9.1 >03_01_0150 + 1191410-1191697,1191818-1191941,1192063-1192121, 1192565-1192629,1192838-1192931,1193005-1193085, 1193176-1193287,1193949-1194036,1194440-1194561, 1194636-1194973,1195579-1195870,1195946-1196016, 1197741-1197849,1198760-1198803,1198804-1198847, 1200431-1200524 Length = 674 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 518 SWTAQGPPRHRAKDTGQKVTHPLRNENQMSHIPDA 414 SW G +A D +K++H LR+ N + +PDA Sbjct: 530 SWAESG--FIKAYDRAEKISHRLRDNNDNTEMPDA 562 >12_01_0592 + 4848467-4849164,4849413-4849491 Length = 258 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 559 GDNSTDARVGADRRAGLHKDH 497 GD++ D R+GA+R+ G H H Sbjct: 201 GDSAHDQRMGAERKEGAHLRH 221 >06_03_1183 + 28237467-28237612,28238035-28238089,28238216-28238354, 28238433-28238487,28238578-28238646,28239338-28239560, 28239645-28239740,28240708-28240827,28240937-28241062, 28241369-28241524,28242706-28242828,28242913-28242980, 28243119-28243254,28243365-28243530,28243615-28243853 Length = 638 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 621 RVLRHGGAVPPQVLLKDYL 565 + L+HGGA P LLKD++ Sbjct: 595 KFLKHGGAKDPSALLKDFV 613 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,701,911 Number of Sequences: 37544 Number of extensions: 303459 Number of successful extensions: 658 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -