BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0350 (622 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59316| Best HMM Match : LRR_1 (HMM E-Value=0) 28 5.3 SB_534| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 >SB_59316| Best HMM Match : LRR_1 (HMM E-Value=0) Length = 680 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -3 Query: 449 RNENQMSHIPDAGGSKTSPVSLVNDYKHIICLTNESG 339 +N N +SH+PD+ + L D ++CL ++ G Sbjct: 318 QNGNWLSHLPDSFSQMANLTKLHLDENQVVCLPDDFG 354 >SB_534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 948 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 239 HKQEVHIVWVAKPDMHRYIRLTLLVI 162 H +EV +VW+ KP ++R R+ + V+ Sbjct: 877 HFKEVSLVWLVKPRLNRKWRIVMRVV 902 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,539,987 Number of Sequences: 59808 Number of extensions: 368751 Number of successful extensions: 747 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -