BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0350 (622 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 7.3 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 7.3 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 7.3 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 7.3 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 7.3 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 7.3 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 7.3 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 7.3 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 21 7.3 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 9.7 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 9.7 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 9.7 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 9.7 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 9.7 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 9.7 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 9.7 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 9.7 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 9.7 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 9.7 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 9.7 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 9.7 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 9.7 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 9.7 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 9.7 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 9.7 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 9.7 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 9.7 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 9.7 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 9.7 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 9.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 9.7 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 9.7 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 9.7 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 9.7 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 45 QQEREREHERLKKKMILEYELRR 67 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 45 QQEREREHERLKKKMILEYELRR 67 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 45 QQEREREHERLKKKMILEYELRR 67 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 45 QQEREREHERLKKKMILEYELRR 67 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 45 QQEREREHERLKKKMILEYELRR 67 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 45 QQEREREHERLKKKMILEYELRR 67 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 45 QQEREREHERLKKKMILEYELRR 67 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 45 QQEREREHERLKKKMILEYELRR 67 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 Query: 448 RSGWVTFCPVSL 483 R G++TFCP +L Sbjct: 263 RLGFLTFCPTNL 274 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHERLMKKMILEYELRR 68 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHERLMKKMILEYELRR 68 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHERLMKKMILEYELRR 68 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHERLMKKMILEYELRR 68 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHERLMKKMILEYELRR 68 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHERLMKKMILEYELRR 68 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHERLMKKMILEYELRR 68 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHERLMKKMILEYELRR 68 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLTKKMILEYELRR 68 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 526 QRRRERLWSYLHFQVVLEQDLRR 594 Q+ RER L +++LE +LRR Sbjct: 46 QQEREREHQRLMKKMILEYELRR 68 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -1 Query: 481 KILDRK*PIHYAMKIKCLISPTQVALKRHRYHLSM 377 K+ D K YA+ K + +PT+ + H+S+ Sbjct: 131 KMSDEKISTLYALGAKIIRTPTEASWHSPEAHISV 165 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,138 Number of Sequences: 438 Number of extensions: 3515 Number of successful extensions: 35 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -