BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0344 (674 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.052 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) 30 1.5 SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_12062| Best HMM Match : NUC129 (HMM E-Value=9.2) 29 2.6 SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_2262| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 7.9 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -2 Query: 397 DVVAVSQAPSPESNPDSPLPVTTM 326 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 388 AVSQAPSPESNPDSPLPVTTM 326 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 38.3 bits (85), Expect = 0.006 Identities = 20/46 (43%), Positives = 25/46 (54%) Frame = +1 Query: 508 NILTRNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 645 +++ R +WRASL Y K+VAVKKLVV F VG P Sbjct: 57 HLVIRIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 102 >SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 37.1 bits (82), Expect = 0.013 Identities = 20/42 (47%), Positives = 22/42 (52%) Frame = +1 Query: 520 RNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 645 R +WRASL Y K+VAVKKLVV F VG P Sbjct: 14 RIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 55 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.052 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 387 PFLRLPLRNRTLIPRYP 337 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 0.64 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +1 Query: 532 RASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 645 RASL Y K+VAVKKLVV F VG P Sbjct: 5 RASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 42 >SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) Length = 203 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -3 Query: 672 RKRVSITRMRCTDSAAHKCNYELFNRNNFSIRYWSWNYRGCWH 544 ++R+ I + C A C + RN +RYW W R C H Sbjct: 75 KRRLIIATLFCVVFIA--CEVTVIARNILPVRYWIWLSRKCGH 115 >SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +1 Query: 520 RNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 645 R ASL Y K+VAVKKLVV F VG P Sbjct: 24 RERRAASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 65 >SB_12062| Best HMM Match : NUC129 (HMM E-Value=9.2) Length = 111 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 580 YTKIVAVKKLVVAFVRRAVGAP 645 Y K+VAVKKLVV F VG P Sbjct: 88 YIKVVAVKKLVVGFRDGTVGPP 109 >SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 580 YTKIVAVKKLVVAFVRRAVGAP 645 Y K+VAVKKLVV F VG P Sbjct: 89 YIKVVAVKKLVVGFRDGTVGPP 110 >SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 580 YTKIVAVKKLVVAFVRRAVGAP 645 Y K+VAVKKLVV F VG P Sbjct: 17 YIKVVAVKKLVVGFRDGTVGPP 38 >SB_2262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 688 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = -2 Query: 403 SLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES**GRHLKDASPVLDQRSAKVIQI 230 S VV + A + P P+ VTT V A T E+ + +A+P+L + +K + + Sbjct: 120 SSPVVTTAVASAASLKPSKPIVVTTAVAALPTPETSVAVSIPNAAPLLMPQPSKDVHL 177 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 406 PSLDVVAVSQAPSPESNPDSPLP 338 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,840,916 Number of Sequences: 59808 Number of extensions: 433488 Number of successful extensions: 1101 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1100 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -