BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0343 (721 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 5.4 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 5.4 AY745229-1|AAU93509.1| 56|Anopheles gambiae glutaredoxin protein. 23 7.2 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 7.2 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 23 9.5 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 23 9.5 AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-b... 23 9.5 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -1 Query: 580 PPGSVLEP-DHAGVLNGD 530 PPGS+L+P D A V+ G+ Sbjct: 1092 PPGSILDPSDGAAVVGGN 1109 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 5.4 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 202 DEAFGYLKRVIVTPAVYPRLLEFLHV-DIQSTGQKSHC 92 D +F L RV TPA P +EFL + D + HC Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLNDNHIVHVEPHC 670 >AY745229-1|AAU93509.1| 56|Anopheles gambiae glutaredoxin protein. Length = 56 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 4/24 (16%) Frame = +3 Query: 555 SGSRTLP----GGEFDWGGTSVKE 614 +G+RT+P GG F GGT +K+ Sbjct: 21 TGARTVPRVFIGGNFVGGGTDIKK 44 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 7.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 601 VPPQSNSPPGSVLEPD 554 +PP SNS P S PD Sbjct: 868 MPPSSNSSPSSYPSPD 883 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 517 HVTLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVV 407 HV+ T+ ++ AP D A + RVS + V+V Sbjct: 819 HVSAVTIMSRTHAPGDAPHIADVKEQRVSGFVVSVLV 855 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +2 Query: 380 DRFARSSLKNHYFHCFITYSVGRKRC 457 DRFA ++ + H F+ + G + C Sbjct: 425 DRFALAATHARHTHAFLPFGDGPRNC 450 >AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-binding protein OBPjj11 protein. Length = 135 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 25 HGQGESDCLI-KTKHCDGPRGC*RNVISAQC 114 +GQ ++D L+ + ++ DGP C R+ QC Sbjct: 95 YGQEKADELVARCRNNDGPDACERSFRLLQC 125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 774,660 Number of Sequences: 2352 Number of extensions: 16769 Number of successful extensions: 30 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -