BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0341 (653 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n... 55 1e-06 UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 40 0.052 UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lu... 36 1.1 UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 34 2.6 UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ... 34 2.6 UniRef50_A5LFU4 Cluster: Putative uncharacterized protein; n=2; ... 33 6.0 UniRef50_A0B8I7 Cluster: DEAD/DEAH box helicase domain protein; ... 33 6.0 UniRef50_A1VP16 Cluster: Peptidase C14, caspase catalytic subuni... 33 7.9 >UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1; Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry - Gallus gallus Length = 103 Score = 55.2 bits (127), Expect = 1e-06 Identities = 32/59 (54%), Positives = 36/59 (61%) Frame = -3 Query: 180 GAPTARRTNATTSFLTATILVYXXXXXXXXXXXTRLALQLFLVKIFKVYSFRLRGLVRV 4 G P AR + TTSFLTA L+Y TRLALQ LVK FKV SF+L+GL RV Sbjct: 30 GGPPARSQDPTTSFLTAATLIYAIGAGITAAAGTRLALQWILVKGFKVDSFQLQGLERV 88 >UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Nematostella vectensis Length = 79 Score = 39.9 bits (89), Expect = 0.052 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = +3 Query: 528 FHQSRTKVRGSKAIRYRPSSNRK 596 F RTKVRGSK IRYRPSSN K Sbjct: 6 FRCQRTKVRGSKTIRYRPSSNHK 28 >UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 72 Score = 35.5 bits (78), Expect = 1.1 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +3 Query: 528 FHQSRTKVRGSKAIRYRPSSNRK 596 FH RTKV GSK IRY PS N K Sbjct: 6 FHCQRTKVGGSKMIRYHPSLNHK 28 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 34.3 bits (75), Expect = 2.6 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -2 Query: 523 LWQMLR*CSSCDDPRISPLTSQYECPQ 443 L + R C S ++ RISPLTS+Y+CPQ Sbjct: 258 LGKCFRSCLSPENLRISPLTSEYKCPQ 284 >UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 76 Score = 34.3 bits (75), Expect = 2.6 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 106 SWNYRGCWHQTCP 68 SWNYR CWHQT P Sbjct: 7 SWNYRSCWHQTGP 19 >UniRef50_A5LFU4 Cluster: Putative uncharacterized protein; n=2; Streptococcus pneumoniae|Rep: Putative uncharacterized protein - Streptococcus pneumoniae SP3-BS71 Length = 81 Score = 33.1 bits (72), Expect = 6.0 Identities = 28/75 (37%), Positives = 35/75 (46%) Frame = +2 Query: 116 YTKIVAVKKLVVAFVRRAVGAPHPR*Y*HVCGHIVGEPAF*KTPVQFKILSRCSSVSVEV 295 Y K+VAVKKLVV R + G I F P +L+ S+ + Sbjct: 13 YIKVVAVKKLVVELWAR------------LAGPIFSCTGFPTGPF---LLANLESLWLLA 57 Query: 296 GRQFYFEQIRVLKAG 340 R FYFE+IRV KAG Sbjct: 58 NRDFYFEKIRVFKAG 72 >UniRef50_A0B8I7 Cluster: DEAD/DEAH box helicase domain protein; n=1; Methanosaeta thermophila PT|Rep: DEAD/DEAH box helicase domain protein - Methanosaeta thermophila (strain DSM 6194 / PT) (Methanothrixthermophila (strain DSM 6194 / PT)) Length = 820 Score = 33.1 bits (72), Expect = 6.0 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +3 Query: 474 EILGSSQDEHQR-SICQRCFHQSRTKVRGSKAIRYR 578 E+L + Q +H+R S+CQ C + R K+ G ++ YR Sbjct: 82 ELLNAYQLKHRRVSVCQHCLGRRRVKLLGEDSVSYR 117 >UniRef50_A1VP16 Cluster: Peptidase C14, caspase catalytic subunit p20; n=1; Polaromonas naphthalenivorans CJ2|Rep: Peptidase C14, caspase catalytic subunit p20 - Polaromonas naphthalenivorans (strain CJ2) Length = 562 Score = 32.7 bits (71), Expect = 7.9 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -2 Query: 202 VSVSPRMRCTDSAAHKCNYELFNRNNFSIRYWS 104 V+ PR+R D AA + NY L NR+N+ + W+ Sbjct: 163 VNAPPRVRAADPAAVQANY-LANRSNYEVSQWT 194 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 585,937,946 Number of Sequences: 1657284 Number of extensions: 10603908 Number of successful extensions: 23410 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 22787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23403 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 49173558301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -