BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0341 (653 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|c... 29 0.59 SPBC26H8.11c |||conserved fungal protein|Schizosaccharomyces pom... 25 7.2 SPCC1620.07c |||lunapark homolog|Schizosaccharomyces pombe|chr 3... 25 7.2 SPAP27G11.16 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 9.5 >SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 288 Score = 29.1 bits (62), Expect = 0.59 Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 396 YFVGFQN-SEVMINRDNWGHSYCDVRGEIL 482 Y VG+ N + ++++ WGHS+ +V E+L Sbjct: 142 YIVGYPNEARLLMDNFKWGHSFFEVNEELL 171 >SPBC26H8.11c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 175 Score = 25.4 bits (53), Expect = 7.2 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 496 TNISEAFAKGVFINQERKLEVRRRLDTALV 585 T + EA A GVF N K+ V +LDT V Sbjct: 84 TMLDEALAFGVFPNFPSKMGVTVQLDTTYV 113 >SPCC1620.07c |||lunapark homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 334 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 486 SSQDEHQRSICQRCFHQSRTKVRGSKA--IRY 575 +S++ + IC CFH + G KA +RY Sbjct: 191 NSENNREALICSHCFHHNGLASYGEKASDVRY 222 >SPAP27G11.16 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 104 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 166 AAHKCNYELFNRNNFSIRYWSWNYR 92 AA KC +E FSI + S+N++ Sbjct: 73 AASKCEFEKIWSTTFSISFLSFNFK 97 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,392,004 Number of Sequences: 5004 Number of extensions: 43833 Number of successful extensions: 98 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -