BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0333 (626 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1289.10c |||transcription factor |Schizosaccharomyces pombe|... 28 1.3 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 27 2.2 SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/F... 27 2.2 SPAC823.03 |ppk15||serine/threonine protein kinase Ppk15 |Schizo... 27 2.9 SPAC56F8.08 |mud1|ucp1, ddi1|UBA domain protein Mud1|Schizosacch... 26 5.1 >SPBC1289.10c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 743 Score = 27.9 bits (59), Expect = 1.3 Identities = 24/87 (27%), Positives = 36/87 (41%), Gaps = 1/87 (1%) Frame = -3 Query: 384 THEHRPDPAPAHPLPVQTRHAPVLRANPYSEVTDPICRLPLPTYSID*RLFTLETCCGYG 205 TH RP P + PL V+++ P AN + P P S + T G Sbjct: 591 THSSRPTPNASSPLDVRSKQKP-SSANSNAPTPAPTVNTTNPESSTN-----EATSVGPA 644 Query: 204 YEPARHLHVHPS-PEFSRSAESIRTPP 127 EP++ +VH S E +S ++ P Sbjct: 645 LEPSQGANVHKSDSELDNQNQSGKSNP 671 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 27.1 bits (57), Expect = 2.2 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = -3 Query: 315 LRANPYSEVTDPICRLPLPTYSID*RLFTLETCCGYGYEPARHL 184 L + + P P S+D R+F LE+ GY EP L Sbjct: 144 LNSKTSESLKSPTLSYPFDLDSLDKRIFKLESKIGYADEPLSEL 187 >SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/Flp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 27.1 bits (57), Expect = 2.2 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = -1 Query: 215 ADMGTNRRDISTYIPHLNFQGPQRVSGHRRKCGALRVPNHISL 87 A GT++ +IST +P P++VSGH A R+P+ S+ Sbjct: 371 ATNGTSQSNISTPLPEPTPGQPRKVSGHNPP-SARRLPSASSV 412 >SPAC823.03 |ppk15||serine/threonine protein kinase Ppk15 |Schizosaccharomyces pombe|chr 1|||Manual Length = 534 Score = 26.6 bits (56), Expect = 2.9 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = -1 Query: 302 LIPKLRIQFADFPYLHILSTRGSSPWRPAADMGT---NRRDISTYIPHLNFQGPQRVSGH 132 L+ + RI D +IL SSP D G+ R+ + TYI ++ P+ + G Sbjct: 247 LLKQARIIHCDLKPENILLQDLSSPIVKVIDFGSACHERQTVYTYIQSRFYRSPEVILGL 306 Query: 131 RRKCG 117 CG Sbjct: 307 HYNCG 311 >SPAC56F8.08 |mud1|ucp1, ddi1|UBA domain protein Mud1|Schizosaccharomyces pombe|chr 1|||Manual Length = 332 Score = 25.8 bits (54), Expect = 5.1 Identities = 25/69 (36%), Positives = 30/69 (43%), Gaps = 6/69 (8%) Frame = -2 Query: 451 HIKYIQFLRPHYIKILTR*NEHNART---STRPGTGASASRPNP---TRPGPQSQSLFRS 290 H K I FL I L E +A P + ASAS PNP TR G + + Sbjct: 219 HGKEIPFLGESEIPKLLANVEPSANAHGLGIEPASKASASSPNPQSGTRLGTKESVAPNN 278 Query: 289 YGSNLPTSL 263 GS+ P SL Sbjct: 279 EGSSNPPSL 287 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,632,466 Number of Sequences: 5004 Number of extensions: 56602 Number of successful extensions: 167 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 166 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -