BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0331 (676 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81067-4|CAB02976.2| 632|Caenorhabditis elegans Hypothetical pr... 28 7.0 AF099925-14|AAX55690.1| 679|Caenorhabditis elegans Calcium bind... 28 7.0 Z81588-2|CAB04712.1| 379|Caenorhabditis elegans Hypothetical pr... 27 9.2 Z81579-4|CAE17915.1| 212|Caenorhabditis elegans Hypothetical pr... 27 9.2 >Z81067-4|CAB02976.2| 632|Caenorhabditis elegans Hypothetical protein F23A7.5 protein. Length = 632 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +2 Query: 521 RHLKDASPVLDHAICKSYPDSSKLTTSDARPPSIGFDLIKALIP 652 R ++ PVL A K+ +S T S PP IG K +P Sbjct: 476 RFAREKYPVLSRATSKACGGNSNRTASLIDPPQIGLSKSKPTLP 519 >AF099925-14|AAX55690.1| 679|Caenorhabditis elegans Calcium binding protein homologprotein 1, isoform d protein. Length = 679 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 402 LPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTI 506 +P+ V+ ++ PS +S + VTT V+ TTI Sbjct: 559 VPTTTVIQTTETPSTKSKTTKKVKVTTTTVSTTTI 593 >Z81588-2|CAB04712.1| 379|Caenorhabditis elegans Hypothetical protein T07D10.2 protein. Length = 379 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 385 GNLRACCLPWMW*PFLRLPLR 447 GNL +C PW+W F R L+ Sbjct: 330 GNLNSCMNPWLWFHFNRKQLK 350 >Z81579-4|CAE17915.1| 212|Caenorhabditis elegans Hypothetical protein R13H4.8 protein. Length = 212 Score = 27.5 bits (58), Expect = 9.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 Query: 219 CCG*KARSCICAPRCRC 169 CCG C C PRC C Sbjct: 79 CCGCGCGCCCCRPRCCC 95 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,572,648 Number of Sequences: 27780 Number of extensions: 335879 Number of successful extensions: 1039 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1033 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1529108810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -