BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0331 (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 25 0.66 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 4.7 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 8.1 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 8.1 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 8.1 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 8.1 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 8.1 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 8.1 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 25.0 bits (52), Expect = 0.66 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -3 Query: 641 LLLDQNQSTEASRPKSLILMNLDNFCRSHGQVPAT 537 +L S + P+ L +NL + CR HG PAT Sbjct: 417 VLFPSLDSRDELHPRELEAVNLGSACRIHGS-PAT 450 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 415 SKEGSRRANYPLPARGGSDEK*RYG 341 +K S+ AN P PA GG + + G Sbjct: 1014 AKPQSQEANKPKPATGGKGTRPKRG 1038 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 177 SAAHKCNYELFNRNNFSIRYWSWNY 251 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 177 SAAHKCNYELFNRNNFSIRYWSWNY 251 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 177 SAAHKCNYELFNRNNFSIRYWSWNY 251 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 177 SAAHKCNYELFNRNNFSIRYWSWNY 251 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 177 SAAHKCNYELFNRNNFSIRYWSWNY 251 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.4 bits (43), Expect = 8.1 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +3 Query: 243 WNYRAAGTRLALQLFLVKIFKVYSFRLRGLVRVPYRY 353 WN LA+ LFL + V+ L L V RY Sbjct: 39 WNLATDRAGLAILLFLFSVATVFGNTLVILAVVRERY 75 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,699 Number of Sequences: 438 Number of extensions: 4346 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -