BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0329 (637 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48007-2|CAA88053.2| 1118|Caenorhabditis elegans Hypothetical pr... 29 3.7 Z81142-8|CAO82053.1| 370|Caenorhabditis elegans Hypothetical pr... 28 6.4 AC006632-2|AAK85468.1| 478|Caenorhabditis elegans Hypothetical ... 27 8.5 >Z48007-2|CAA88053.2| 1118|Caenorhabditis elegans Hypothetical protein R134.2 protein. Length = 1118 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +3 Query: 321 NILKKTLFYINSGIEVDCRFNSADTRVNETFWCS 422 NI+ K Y+N D F S +R FWC+ Sbjct: 210 NIVIKAEIYLNDNETTDIVFQSVKSRARIIFWCT 243 >Z81142-8|CAO82053.1| 370|Caenorhabditis elegans Hypothetical protein ZK1037.13 protein. Length = 370 Score = 27.9 bits (59), Expect = 6.4 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 348 INSGIEVDCRFNSADTRVNETFWCSTATRIWRCKNVNAAPSALRH 482 I+SG DC+ SA +E+ + R+ +C NV P A++H Sbjct: 71 ISSGNVGDCKKQSACEINHESKNSCRSCRLQKCLNVGMNPKAIQH 115 >AC006632-2|AAK85468.1| 478|Caenorhabditis elegans Hypothetical protein F28A10.2 protein. Length = 478 Score = 27.5 bits (58), Expect = 8.5 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -2 Query: 495 RI*PHVSRQMG--RHSHFYISIFW*PLNTKMSHLPLCLPN*NGNQLL 361 R+ H+S ++G + Y+SI + P + +S L +PN GN L+ Sbjct: 286 RMGSHISSELGAFERDNPYLSILYQPQSEYLSREVLQIPNEKGNSLI 332 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,666,587 Number of Sequences: 27780 Number of extensions: 240167 Number of successful extensions: 375 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1406256614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -