BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0329 (637 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15320.1 68417.m02344 cellulose synthase family protein simil... 28 4.5 At1g47783.1 68414.m05315 hypothetical protein 28 6.0 >At4g15320.1 68417.m02344 cellulose synthase family protein similar to Zea mays cellulose synthase-5 [gi:9622882], -2 [gi:9622876], -1 [gi:9622874] Length = 828 Score = 28.3 bits (60), Expect = 4.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 630 ITHLSIYIMLVYESLEICQSRAAYFCH 550 +THLS + +L+Y + + RA FC+ Sbjct: 326 LTHLSFFDILIYLKINVNDCRAVSFCY 352 >At1g47783.1 68414.m05315 hypothetical protein Length = 137 Score = 27.9 bits (59), Expect = 6.0 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 4/39 (10%) Frame = +3 Query: 351 NSGIEVDCRF--NSADTRVNETFWCSTATRIWR--CKNV 455 N+G +V C F S +TR + F CS A+ IW KNV Sbjct: 5 NNGSDVKCTFCSTSIETRDHLFFSCSYASSIWTAIAKNV 43 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,641,773 Number of Sequences: 28952 Number of extensions: 209872 Number of successful extensions: 302 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 302 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1305036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -