BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0326 (668 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X81649-1|CAA57309.1| 850|Homo sapiens gastric mucin protein. 31 3.7 AJ298317-1|CAC83674.1| 2448|Homo sapiens mucin 5 protein. 31 3.7 >X81649-1|CAA57309.1| 850|Homo sapiens gastric mucin protein. Length = 850 Score = 31.1 bits (67), Expect = 3.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 593 RSRETISHLCYTSHVSLQCQTRVKLNRVSFPADSPKP 483 R+RE S LCY + +QC T + + S PA + P Sbjct: 453 RNREQASGLCYNYQIRVQCCTPLACSTSSSPAQTTPP 489 >AJ298317-1|CAC83674.1| 2448|Homo sapiens mucin 5 protein. Length = 2448 Score = 31.1 bits (67), Expect = 3.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 593 RSRETISHLCYTSHVSLQCQTRVKLNRVSFPADSPKP 483 R+RE S LCY + +QC T + + S PA + P Sbjct: 1457 RNREQASGLCYNYQIRVQCCTPLPCSTSSSPAQTTPP 1493 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,705,299 Number of Sequences: 237096 Number of extensions: 1988035 Number of successful extensions: 3822 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3692 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3822 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7591280850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -