BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0326 (668 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 30 1.2 At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 30 1.6 At5g03420.1 68418.m00295 dentin sialophosphoprotein-related cont... 29 3.7 At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 29 3.7 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 29 3.7 At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /... 29 3.7 At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative... 28 4.9 At5g22740.1 68418.m02656 glycosyl transferase family 2 protein s... 28 6.5 At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi... 28 6.5 At1g22340.1 68414.m02795 UDP-glucoronosyl/UDP-glucosyl transfera... 28 6.5 At5g05360.2 68418.m00577 expressed protein similar to unknown pr... 27 8.5 At5g05360.1 68418.m00578 expressed protein similar to unknown pr... 27 8.5 At1g75010.1 68414.m08709 MORN (Membrane Occupation and Recogniti... 27 8.5 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 102 RTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQN 218 R+RVLRPS + + + +S FR S T R A N Sbjct: 37 RSRVLRPSVKISNFRFISCGFRGNSKNLRLTDSSRKAAN 75 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 85 TFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFNGQLRT 219 T+ T SG R++L+ R+ D HD + PFNG T Sbjct: 179 TYVTQSGSLMMSF-RVYLSNSDASIRYADDVHDRIWSPFNGSSHT 222 >At5g03420.1 68418.m00295 dentin sialophosphoprotein-related contains weak similarity to Swiss-Prot:Q9NZW4 dentin sialophosphoprotein precursor [Homo sapiens] Length = 583 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +1 Query: 457 SSETTAKGTGLGESAGKETLLSLTLVWHCKET*EV*HKWEIVSRDR 594 SSETT G +G+S G ++S L E+ H E+ S DR Sbjct: 374 SSETTKGGEYIGDSLGGPRIMSTPLNGSALALKEIIHATEVNSSDR 419 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 28.7 bits (61), Expect = 3.7 Identities = 9/37 (24%), Positives = 22/37 (59%) Frame = -1 Query: 368 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNA 258 ++T V P ++ F+H I + ++ + V+ + GH+ + Sbjct: 33 VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTS 69 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 28.7 bits (61), Expect = 3.7 Identities = 9/37 (24%), Positives = 22/37 (59%) Frame = -1 Query: 368 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNA 258 ++T V P ++ F+H I + ++ + V+ + GH+ + Sbjct: 32 VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTS 68 >At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory / CAF identical to RNA helicase/RNAseIII CAF protein GB:AAF03534 GI:6102610 from [Arabidopsis thaliana] Length = 1909 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +2 Query: 380 GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKR 511 G +P + +SD + INE+ P +AK +E + GKR Sbjct: 70 GGGLPNNGVSDTNSQINEVTVTP-QVIAKETVKENGLQKNGGKR 112 >At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 239 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 109 RVRIQSET*DDFRECHIKYIQFLRPH 32 R+RIQ DF + + K+++FL PH Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197 >At5g22740.1 68418.m02656 glycosyl transferase family 2 protein similar to beta-(1-3)-glucosyl transferase GB:AAC62210 GI:3687658 from [Bradyrhizobium japonicum], cellulose synthase from Agrobacterium tumeficiens [gi:710492] and Agrobacterium radiobacter [gi:710493]; contains Pfam glycosyl transferase, group 2 family protein domain PF00535 Length = 534 Score = 27.9 bits (59), Expect = 6.5 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +1 Query: 37 ASKTVYI*YDTRENRLTFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPF 201 ASK + I Y RENR+ ++ G+ GL R + V+ C + + D P F Sbjct: 154 ASKGINIRYQIRENRVGYKAGA--LKEGLKRSY--VKHCEYVVIFDADFQPEPDF 204 >At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin like protein A, Arabidopsis thaliana, gb:Q07970 Length = 790 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 659 DRAPLPPNRVSNETMKVVVFQRRSRET 579 +RAPLP V E + + F +R +ET Sbjct: 7 NRAPLPSPNVKKEALSSIPFDKRRKET 33 >At1g22340.1 68414.m02795 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase; similar to UDP-glucose glucosyltransferase GI:3928543 from [Arabidopsis thaliana] Length = 487 Score = 27.9 bits (59), Expect = 6.5 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Frame = -2 Query: 304 GRNHIASTPARAIAMLCLIRQSDSPCPCQF*ADR*TAVVQNRADRARNETDTTLR-LGRS 128 G N + A + M+C S+ P C+F D ++ D R E +T +R L Sbjct: 383 GWNSTLESLAGGVPMICWPCFSEQPTNCKFCCDEWGVGIEIGKDVKREEVETVVRELMDG 442 Query: 127 AEGRRTRVRIQ 95 +G++ R + + Sbjct: 443 EKGKKLREKAE 453 >At5g05360.2 68418.m00577 expressed protein similar to unknown protein (pir||T02500) Length = 153 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 650 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 540 P P+R S V ++ +R+T SHL Y++ V L+ Sbjct: 20 PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56 >At5g05360.1 68418.m00578 expressed protein similar to unknown protein (pir||T02500) Length = 163 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 650 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 540 P P+R S V ++ +R+T SHL Y++ V L+ Sbjct: 20 PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56 >At1g75010.1 68414.m08709 MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein /phosphatidylinositol-4-phosphate 5-kinase-related low similarity to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profile PF02493: MORN repeat Length = 712 Score = 27.5 bits (58), Expect = 8.5 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 4/45 (8%) Frame = -2 Query: 361 LPPFTR-ACLNFFTLTFRALG---RNHIASTPARAIAMLCLIRQS 239 +P F+R A L F + F +LG R + S AR I ++CL+R S Sbjct: 15 VPLFSRLALLPTFGVPFSSLGATTRLNCTSRKARRICVMCLVRDS 59 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,375,749 Number of Sequences: 28952 Number of extensions: 296844 Number of successful extensions: 731 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 731 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -