BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0325 (606 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 23 2.6 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 23 2.6 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 2.6 X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 22 3.5 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 22 3.5 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 3.5 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 3.5 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 22.6 bits (46), Expect = 2.6 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +1 Query: 163 PRSAPTEAPSGLTPRPFCALRRARPTRYGLIYQIKNLASHVPV 291 PRS+P E S L+P+ + + + + L SH P+ Sbjct: 154 PRSSPAETASSLSPQSVASTASSADHQI-----VDRLLSHAPI 191 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 22.6 bits (46), Expect = 2.6 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +1 Query: 163 PRSAPTEAPSGLTPRPFCALRRARPTRYGLIYQIKNLASHVPV 291 PRS+P E S L+P+ + + + + L SH P+ Sbjct: 145 PRSSPAETASSLSPQSVASTASSADHQI-----VDRLLSHAPI 182 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.6 bits (46), Expect = 2.6 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +1 Query: 307 QNASAPSIFRAG--CFGR*VVAHSLADSDFHGHRPAVMSDQRLS 432 + A AP++ AG R A H HRPA+ +R++ Sbjct: 274 ERAPAPAVRAAGDAAAARGAARADGAGGPLHDHRPALAQQRRVA 317 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 22.2 bits (45), Expect = 3.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 538 RSDDGAKWANLVSRTGAVG 482 RS D A A+++SR AVG Sbjct: 88 RSGDEAALADMISRCNAVG 106 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 22.2 bits (45), Expect = 3.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 538 RSDDGAKWANLVSRTGAVG 482 RS D A A+++SR AVG Sbjct: 89 RSGDEAALADMISRCNAVG 107 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.2 bits (45), Expect = 3.5 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 404 GRWPWKSESAKECATTHLPKQPAL 333 GR WK + AT L K P+L Sbjct: 79 GRKAWKHLDFRNSATAELLKNPSL 102 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.2 bits (45), Expect = 3.5 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 404 GRWPWKSESAKECATTHLPKQPAL 333 GR WK + AT L K P+L Sbjct: 79 GRKAWKHLDFRNSATAELLKNPSL 102 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,085 Number of Sequences: 336 Number of extensions: 3150 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -