BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0324 (681 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 59 4e-09 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 54 1e-07 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 52 3e-07 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 42 5e-04 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_41433| Best HMM Match : Neur_chan_LBD (HMM E-Value=4.6e-07) 30 2.0 SB_18498| Best HMM Match : PX (HMM E-Value=1.6e-15) 29 3.5 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 29 3.5 SB_53943| Best HMM Match : PsbQ (HMM E-Value=1.5) 29 4.6 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 58.8 bits (136), Expect = 4e-09 Identities = 33/61 (54%), Positives = 39/61 (63%) Frame = -1 Query: 624 ERPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPTWHRIRSPASSFE*AGVLTHLKFEN 445 E+PTPF+ S ER L FGSS ASS YQN PT RI P + + G+LT+LKFEN Sbjct: 58 EQPTPFVGSDERRLWHPYRAFGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTNLKFEN 116 Query: 444 R 442 R Sbjct: 117 R 117 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 54.0 bits (124), Expect = 1e-07 Identities = 26/42 (61%), Positives = 28/42 (66%) Frame = +2 Query: 554 DEPNVVFKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQR 679 DEPN + +RS D KGVG S QQDGGHGS NPLR QR Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQR 44 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 52.4 bits (120), Expect = 3e-07 Identities = 26/45 (57%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Frame = -1 Query: 645 WPPSCCH--ERPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 W P + E+PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 71 WLPQASYPCEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 115 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 52.0 bits (119), Expect = 4e-07 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -1 Query: 627 HERPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +E+PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 122 YEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 158 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 51.6 bits (118), Expect = 6e-07 Identities = 27/44 (61%), Positives = 29/44 (65%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPTWHRIRSPAS 490 +PTPF+ S ER L LN FGSS ASSAYQN P RI PAS Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -1 Query: 624 ERPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 E+PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 41 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 76 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -1 Query: 624 ERPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 E+PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 38 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 73 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -1 Query: 624 ERPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 E+PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 39 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 74 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -1 Query: 624 ERPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 E+PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 39 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 74 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/38 (60%), Positives = 26/38 (68%) Frame = +2 Query: 554 DEPNVVFKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 667 DEPN + +RS D KGVG S QQDGGHGS NPL+ Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLK 40 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.6 bits (113), Expect = 2e-06 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT--WHRIRSPASS 487 +PTPF+ S ER L LN FGSS ASSAYQ WPT H + P S Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLGDPLES 48 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.8 bits (111), Expect = 4e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNHAFGSSRIASSAYQKWPT 36 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -1 Query: 624 ERPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 E+PTPF+ S ER L LN FGSS ASSA Q WPT Sbjct: 58 EQPTPFVGSDERRLWHLNRAFGSSRIASSALQKWPT 93 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/35 (62%), Positives = 25/35 (71%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN +GSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAYGSSRIASSAYQKWPT 36 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = +2 Query: 554 DEPNVVFKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 667 DEPN + +RS D KGVG S QQDGGHGS NP + Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNPAK 40 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -1 Query: 621 RPTPFMVSHERFLGALNTTFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ PT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKGPT 36 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 628 TAGRWPWKSESAKECATT 681 TAGRWPWK ESAKEC TT Sbjct: 1 TAGRWPWKLESAKECVTT 18 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 628 TAGRWPWKSESAKECATT 681 TAGRWPWK ESAKEC TT Sbjct: 1 TAGRWPWKLESAKECVTT 18 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 628 TAGRWPWKSESAKECATT 681 TAGRWPWK ESAKEC TT Sbjct: 80 TAGRWPWKLESAKECVTT 97 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +3 Query: 588 NAHGTP*KALVAHDSRTVAMEVGIR 662 +AH TP K LVA DSRTVAMEVGIR Sbjct: 9 DAHQTPQKVLVALDSRTVAMEVGIR 33 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -2 Query: 254 PPSGFPLTST*PGIVHHLSGPSICA 180 PP FPL S GIVHHLSGP+ CA Sbjct: 5 PPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 36.7 bits (81), Expect = 0.017 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -1 Query: 255 ASIRVSPDFDLTRHSSPSFGSQHLCS 178 AS RVS F L RHSSPSFGSQ + S Sbjct: 39 ASTRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 33.1 bits (72), Expect = 0.21 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 315 ISLSPLYPVPTIDLHVRIATAS 250 ISLSPLYP TIDLHVR + S Sbjct: 38 ISLSPLYPNLTIDLHVRSNSCS 59 >SB_41433| Best HMM Match : Neur_chan_LBD (HMM E-Value=4.6e-07) Length = 175 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = -2 Query: 671 HSLADSDFHGHRPAVMSDQRLSWCPMSVF*AP*TLRLVHPTAPVLLTKIGPLG 513 H L ++ + GHR VM Q++ W P S F T ++ H T P +T I P+G Sbjct: 121 HGLNETIYLGHR--VM--QKI-WTPDSYFLNAKTAKMHHVTTPNQMTLIAPMG 168 >SB_18498| Best HMM Match : PX (HMM E-Value=1.6e-15) Length = 402 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -1 Query: 642 PPSCCHERPTPFMVSHERFLGALNTTFGSSHSASS 538 PP+ C ERP+ ++ GAL TT S+ SS Sbjct: 11 PPTVCSERPSSSVIGANDSAGALPTTTNSTCFVSS 45 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -2 Query: 680 VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF 585 + H + ++DF G R A+M+D +L C S+F Sbjct: 386 LTTHFMDEADFLGDRIAIMADGQLRCCGSSLF 417 >SB_53943| Best HMM Match : PsbQ (HMM E-Value=1.5) Length = 540 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 642 PPSCCHERPTPFMVSHERFLGALNTT 565 PP C ERP+ F++ GAL TT Sbjct: 332 PPILCSERPSSFVIGANGSAGALPTT 357 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,627,605 Number of Sequences: 59808 Number of extensions: 456078 Number of successful extensions: 1125 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 992 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1123 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -