BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fbVf0324
(681 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 2.0
D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 6.2
AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 6.2
>AF388659-1|AAK71995.1| 782|Apis mellifera
1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
Length = 782
Score = 23.4 bits (48), Expect = 2.0
Identities = 17/52 (32%), Positives = 25/52 (48%)
Frame = -1
Query: 501 SPASSFE*AGVLTHLKFENRLRSFRPQCL*SFALPDETVLKFYIDASYPEGN 346
S A+S E + TH + ++LR R S L DE K + ++ EGN
Sbjct: 220 STAASDEDISLTTHQQKRHKLRVTRCYSSDSAVLSDEDQTKGWDGSNMVEGN 271
>D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein.
Length = 567
Score = 21.8 bits (44), Expect = 6.2
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -1
Query: 309 LSPLYPVPTID 277
LSP+YP P +D
Sbjct: 71 LSPIYPSPMVD 81
>AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase
protein.
Length = 567
Score = 21.8 bits (44), Expect = 6.2
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -1
Query: 309 LSPLYPVPTID 277
LSP+YP P +D
Sbjct: 71 LSPIYPSPMVD 81
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 188,562
Number of Sequences: 438
Number of extensions: 4473
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20708550
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -