BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0324 (681 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57580.1 68418.m07194 calmodulin-binding protein similar to c... 28 6.6 At5g05570.1 68418.m00605 transducin family protein / WD-40 repea... 27 8.7 At1g74690.1 68414.m08650 calmodulin-binding family protein low s... 27 8.7 >At5g57580.1 68418.m07194 calmodulin-binding protein similar to calmodulin-binding protein TCB60 GI:1698548 from [Nicotiana tabacum] Length = 647 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +2 Query: 191 WDPKDGELCLVRSKSGET-LMEAVAILTCKSIVGTGYRGERLIEPSSSWFRPK 346 W ++ E +V+ +SG+ L+ +T K VGT GE + +SSW R + Sbjct: 160 WTQEEFESHVVKERSGKRPLLTGEVYVTLKEGVGT--LGELVFTDNSSWIRSR 210 >At5g05570.1 68418.m00605 transducin family protein / WD-40 repeat family protein similar to unknown protein (pir||T04661); contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 2 weak)|8683726|gb|AV524198.1|AV524198 Length = 1124 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/28 (53%), Positives = 20/28 (71%), Gaps = 3/28 (10%) Frame = -1 Query: 324 DGSISLSPL-YP--VPTIDLHVRIATAS 250 + IS+SPL YP VPT+D H+ +AT S Sbjct: 414 ENKISVSPLPYPMVVPTMDPHMTVATFS 441 >At1g74690.1 68414.m08650 calmodulin-binding family protein low similarity to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 587 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -1 Query: 498 PASSFE*AGVLTHLKFENRLRSFR 427 PAS+FE + V T +FE RSFR Sbjct: 290 PASNFESSSVQTSFEFEKPKRSFR 313 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,180,829 Number of Sequences: 28952 Number of extensions: 325961 Number of successful extensions: 684 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1438152744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -