BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0323 (473 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 28 0.83 SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|c... 25 5.9 SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Pa... 25 5.9 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 25 5.9 >SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 27.9 bits (59), Expect = 0.83 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +2 Query: 290 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIQMFSTHRDCESTAY 424 Y+C + +S G L SED ++ W K GLI+ F + E+ Y Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWENLDY 173 >SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 25.0 bits (52), Expect = 5.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -1 Query: 323 LRTPALFFDRCTAPVKLPAWQCPEP 249 LRT +DRC P+K W EP Sbjct: 53 LRTKFNTYDRCIPPMKKSLWGWIEP 77 >SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Par2|Schizosaccharomyces pombe|chr 1|||Manual Length = 627 Score = 25.0 bits (52), Expect = 5.9 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 463 WHLLLKTLYTKGSIGRAFAVPMRTEH 386 +H + + L GSI FAVP++ EH Sbjct: 398 FHGIAELLEILGSIINGFAVPLKEEH 423 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 25.0 bits (52), Expect = 5.9 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 471 NFSGTSC*KLFILKDR*AVLSQSL 400 N G S KLFI+KD V+SQ L Sbjct: 3491 NIGGRSPQKLFIVKDSGQVMSQDL 3514 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,017,998 Number of Sequences: 5004 Number of extensions: 40833 Number of successful extensions: 91 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 182448900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -