BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0321 (356 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A prot... 22 1.6 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 22 1.6 AF017414-2|AAB70261.1| 150|Tribolium castaneum abdominal-A prot... 22 1.6 AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII pr... 22 1.6 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 5.0 AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 21 5.0 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 21 5.0 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 21 5.0 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 20 8.7 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 20 8.7 >AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A protein. Length = 284 Score = 22.2 bits (45), Expect = 1.6 Identities = 12/46 (26%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -3 Query: 252 QKCRNDVSTTSVNTPS-LVLNFTIKCHHVSNLARAVSSTFALLSLS 118 + CR + TP+ ++N+T+ HH + A + +S+ + S S Sbjct: 49 KSCRYTAGLAANVTPADSMVNYTLGQHHHNGAAVSAASSVSAASAS 94 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 22.2 bits (45), Expect = 1.6 Identities = 12/46 (26%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -3 Query: 252 QKCRNDVSTTSVNTPS-LVLNFTIKCHHVSNLARAVSSTFALLSLS 118 + CR + TP+ ++N+T+ HH + A + +S+ + S S Sbjct: 108 KSCRYTAGLAANVTPADSMVNYTLGQHHHNGAAVSAASSVSAASAS 153 >AF017414-2|AAB70261.1| 150|Tribolium castaneum abdominal-A protein. Length = 150 Score = 22.2 bits (45), Expect = 1.6 Identities = 12/46 (26%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -3 Query: 252 QKCRNDVSTTSVNTPS-LVLNFTIKCHHVSNLARAVSSTFALLSLS 118 + CR + TP+ ++N+T+ HH + A + +S+ + S S Sbjct: 49 KSCRYTAGLAANVTPADSMVNYTLGQHHHNGAAVSAASSVSAASAS 94 >AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII protein. Length = 209 Score = 22.2 bits (45), Expect = 1.6 Identities = 12/46 (26%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -3 Query: 252 QKCRNDVSTTSVNTPS-LVLNFTIKCHHVSNLARAVSSTFALLSLS 118 + CR + TP+ ++N+T+ HH + A + +S+ + S S Sbjct: 108 KSCRYTAGLAANVTPADSMVNYTLGQHHHNGAAVSAASSVSAASAS 153 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 20.6 bits (41), Expect = 5.0 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 38 WSVLIDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEETALAK 163 W+ ID F T+ V + +L L NA+V+ TAL K Sbjct: 102 WT-FIDVFIMLTSTAFVFRLKQLNAKVEMLKNARVKNTALWK 142 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 20.6 bits (41), Expect = 5.0 Identities = 5/13 (38%), Positives = 9/13 (69%) Frame = +3 Query: 291 SWSNIRQAINEMC 329 +W N+R+ N +C Sbjct: 265 AWKNLREDYNRLC 277 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 20.6 bits (41), Expect = 5.0 Identities = 5/13 (38%), Positives = 9/13 (69%) Frame = +3 Query: 291 SWSNIRQAINEMC 329 +W N+R+ N +C Sbjct: 265 AWKNLREDYNRLC 277 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 20.6 bits (41), Expect = 5.0 Identities = 5/13 (38%), Positives = 9/13 (69%) Frame = +3 Query: 291 SWSNIRQAINEMC 329 +W N+R+ N +C Sbjct: 265 AWKNLREDYNRLC 277 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 19.8 bits (39), Expect = 8.7 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -3 Query: 144 STFALLSLSGITS 106 +TF LL ++G+TS Sbjct: 205 TTFGLLPVNGVTS 217 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 19.8 bits (39), Expect = 8.7 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 225 TSVNTPSLVLNFTIKC 178 ++V TP+ V++ TI C Sbjct: 308 STVQTPTTVMSPTINC 323 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,750 Number of Sequences: 336 Number of extensions: 1506 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7193380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -