BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0321 (356 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.5 AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.5 AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 6.0 AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. 22 6.0 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 22 7.9 >AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 4.5 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K V+ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----VVALRFNNAFVEE 37 >AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 4.5 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K V+ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----VVALRFNNAFVEE 37 >AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 50 IDTFAKETNDNCVNKRLKLLVIPLRLNNAKVEE 148 ID A+ + C K ++ LR NNA VEE Sbjct: 10 IDPLAQYVFEPCTGK-----IVALRFNNAFVEE 37 >AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. Length = 128 Score = 22.2 bits (45), Expect = 6.0 Identities = 8/31 (25%), Positives = 14/31 (45%) Frame = +2 Query: 23 RAFQCWSVLIDTFAKETNDNCVNKRLKLLVI 115 R CW++ + A T+ CV K ++ Sbjct: 37 RTLLCWAIKLSPTAYVTDAECVRSHRKHQIV 67 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 21.8 bits (44), Expect = 7.9 Identities = 13/49 (26%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 208 WCIY*CSTDIISTFL-FGKYNASGKPSFIPGQISDKLSMKCVDAFVEIG 351 W ++ S+ ++ + +Y A KP F ++DKL K + IG Sbjct: 139 WRVFGISSGCVAFVMALERYIALAKPFFYHKYVTDKLIRKSIFILWGIG 187 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 339,377 Number of Sequences: 2352 Number of extensions: 5996 Number of successful extensions: 49 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 26224815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -