Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0317
         (770 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7QX85 Cluster: GLP_217_30794_34039; n=1; Giardia lambl...    36   1.1  

>UniRef50_Q7QX85 Cluster: GLP_217_30794_34039; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_217_30794_34039 - Giardia lamblia
           ATCC 50803
          Length = 1081

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
 Frame = +3

Query: 303 CTEQYFNILKKTL-FYINSGIEVDCRFNSADTRVNETFWCSTATRIWRCKNVNAAP 467
           CT  Y    KK L     +G  ++  FN  D   +  F CS++T+  RCKN+ + P
Sbjct: 789 CTHCYEGANKKLLCLRCTNGYWLNKAFNRCDACPSNCFECSSSTQCLRCKNIRSPP 844


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 628,717,409
Number of Sequences: 1657284
Number of extensions: 10940851
Number of successful extensions: 19566
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 18952
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19566
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 64615845515
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)