BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0311 (573 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.041 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 32 0.38 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 32 0.38 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 6.2 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 6.2 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 1e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 417 DVVAVSQAPSPESNPDSPLPVTTM 346 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -1 Query: 408 AVSQAPSPESNPDSPLPVTTM 346 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = +3 Query: 3 VVICLSQRLSHACLSASRIKAIPRMA 80 VVICLSQRLSHACLS S RMA Sbjct: 136 VVICLSQRLSHACLSISTCTVKLRMA 161 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.010 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = +3 Query: 3 VVICLSQRLSHACLSASRIKAIPRMA 80 VVICLSQRLSHACLS S RMA Sbjct: 112 VVICLSQRLSHACLSISTRTVKLRMA 137 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.041 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 407 PFLRLPLRNRTLIPRYP 357 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 31.9 bits (69), Expect = 0.38 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +1 Query: 7 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 141 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 447 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 491 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 31.9 bits (69), Expect = 0.38 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +1 Query: 7 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 141 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 866 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 910 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 426 PSLDVVAVSQAPSPESNPDSPLP 358 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/68 (20%), Positives = 36/68 (52%) Frame = +3 Query: 336 LRLPWLSRVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGR**RKITIRDSYEASYRN 515 +RL + +TG ++P +R+P+ R +A +++ ++ +G ++ + ++ + N Sbjct: 762 MRLEFFGCITGKLCNLPMGLQSRRIPNKRISAASEV-NANNGAAASRLHVGSAWIPKFNN 820 Query: 516 EYTLNIVD 539 Y +VD Sbjct: 821 HYQWLMVD 828 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,111,177 Number of Sequences: 59808 Number of extensions: 378080 Number of successful extensions: 1069 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1069 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1361520496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -