BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0311 (573 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 1.6 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.8 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 3.8 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 3.8 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.0 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.0 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 6.6 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 8.7 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 8.7 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.4 bits (48), Expect = 1.6 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 453 RHGR**RKITIRDSYEASYRNEYTLNI 533 +H R R T+ +SY+AS N +L++ Sbjct: 29 KHSRRHRDFTVAESYDASSSNSDSLSM 55 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.6 bits (46), Expect = 2.8 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +2 Query: 38 MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 172 M C P DT +Y+F R Y + T VI + + TLT Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +1 Query: 10 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 123 Y C + + LRR + ++++VP + +SYL Sbjct: 215 YPCCDEPYPDIFFNITLRRKTLFYTVNLIVPCVSISYL 252 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 3.8 Identities = 19/80 (23%), Positives = 29/80 (36%) Frame = -1 Query: 498 RKSPVSLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 319 R S + TTS GSG V V + S N D+ L + + ++++ Sbjct: 222 RPSYTTATMATTSTPGSGSLPASPADSGVSDVESSTSSGGNEDANLLLKARLNPNSSLQP 281 Query: 318 **GRHLKDASPVLDHAICKS 259 H S L + C S Sbjct: 282 SLASHHSHLSSALGRSACHS 301 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +1 Query: 10 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 123 Y C + + ++ +RR + +++++P + +S+L Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +1 Query: 10 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 123 Y C + + ++ +RR + +++++P + +S+L Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 424 RQQARKLPTPGTGGSDE 474 R+Q RK TPG SDE Sbjct: 1768 RRQQRKQQTPGDVESDE 1784 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 424 RQQARKLPTPGTGGSDE 474 R+Q RK TPG SDE Sbjct: 1764 RRQQRKQQTPGDVESDE 1780 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 6.6 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +3 Query: 228 SEVVNFDESDNFCRSHGQVPATHLS 302 S NFD DN +H A H S Sbjct: 412 SRCANFDNQDNNHYNHNHNQARHSS 436 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +1 Query: 10 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 123 Y C + + ++ +RR + +++++P + +S+L Sbjct: 220 YTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFL 257 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +3 Query: 531 IVDEEHDVAFV 563 I+D+EHD AF+ Sbjct: 470 ILDDEHDDAFI 480 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,916 Number of Sequences: 438 Number of extensions: 3315 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16504155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -