BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0310 (295 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY058593-1|AAL13822.1| 767|Drosophila melanogaster LD28817p pro... 28 1.8 AE014297-1398|AAF54712.1| 767|Drosophila melanogaster CG6962-PA... 28 1.8 AE014296-410|ABI31230.1| 3651|Drosophila melanogaster CG33484-PD... 26 7.1 >AY058593-1|AAL13822.1| 767|Drosophila melanogaster LD28817p protein. Length = 767 Score = 28.3 bits (60), Expect = 1.8 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -3 Query: 194 RDSGNLVNPFMRVTN*MTRHLATLRES*LLPPFTRACLNFFTLTF 60 R G L N + ++ T+ TLRE +P R C++ F TF Sbjct: 536 RSEGFLKNFYKKIFGECTQEEVTLREFSRIPEVLRQCIDAFCRTF 580 >AE014297-1398|AAF54712.1| 767|Drosophila melanogaster CG6962-PA protein. Length = 767 Score = 28.3 bits (60), Expect = 1.8 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -3 Query: 194 RDSGNLVNPFMRVTN*MTRHLATLRES*LLPPFTRACLNFFTLTF 60 R G L N + ++ T+ TLRE +P R C++ F TF Sbjct: 536 RSEGFLKNFYKKIFGECTQEEVTLREFSRIPEVLRQCIDAFCRTF 580 >AE014296-410|ABI31230.1| 3651|Drosophila melanogaster CG33484-PD, isoform D protein. Length = 3651 Score = 26.2 bits (55), Expect = 7.1 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 183 PTVPIYYLAKPQPR 224 P PIY+ AKPQP+ Sbjct: 2877 PPAPIYFTAKPQPQ 2890 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,128,812 Number of Sequences: 53049 Number of extensions: 229694 Number of successful extensions: 552 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 24,988,368 effective HSP length: 73 effective length of database: 21,115,791 effective search space used: 506778984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -