BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0309 (471 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0272 - 17146578-17146691,17146806-17146926,17147260-171473... 27 5.8 >02_03_0272 - 17146578-17146691,17146806-17146926,17147260-17147365, 17147469-17147551,17147688-17147815,17147897-17147983, 17148064-17148174,17148502-17148669,17148753-17148837, 17148921-17149037,17149127-17149203,17149299-17149370, 17150538-17150634,17150750-17150952,17151115-17151217, 17151324-17151391,17151461-17151514,17151595-17151704, 17151982-17152060,17152171-17152233,17153410-17153529, 17153913-17153969,17154071-17154187,17156426-17156476, 17156591-17156689,17156787-17156935,17158090-17158312 Length = 953 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/41 (29%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 289 RTQVLSSKVMRLRTENMINQTNRYLLSV-RDCYRTWNLFCN 408 + Q L++K+ +R + T R++ ++ R Y+ WNL+C+ Sbjct: 893 KLQALTNKLKEVRMTCPLFDTARWVRNLERAYYKMWNLYCS 933 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,489,941 Number of Sequences: 37544 Number of extensions: 172301 Number of successful extensions: 368 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 368 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 955200320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -